KEGG   Caenorhabditis briggsae: CBG07699Help
Entry
CBG07699          CDS       T01054                                 

Definition
Hypothetical protein CBG07699
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cbr  Caenorhabditis briggsae
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cbr01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cbr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cbr00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:cbr00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 2047 aa AA seqDB search
MSVNGHKPDIRKITVTGNALISDGAAPYESIEQFVEQNVNDPEKRRPIRKLLVATNGIAA
VRCMTTIMRLLNHTFRNDKLIHFVCMTTEDETKSNSEYLKSATSLATSPSGSNKNNYANV
DEVLRHAKAEKVDAVWAGWGHASENPELPRRLAENNIVFIGPPASAMFSLGDKIASTIIA
QTVGIPTIAWSGSGITMEKTTRNKGDFVEVPKSLLQAACVKTYQEGLEALKTHNIGFPLM
IKASEGGGGKGIRKCTKLEDFKSMFEEVGLEVSNSPIFLMKCVENARHIEVQLIADRYEN
VISVFTRDCSIQRRCQKIIEEAPACVAPSETRKRMQEDAVRIARYVGYESAGTVEYLYLP
EDDTYFFLELNPRLQVEHPATEMISNISIPAIQIQIAMGLPLHKIPDIRNLYNLPKDGDC
ELPDETLVDTPLHAIAARITSEDPDDSFRPSTGKVKELNFRSSQDAWAYFSVSGGGQVHE
YADSQFGHLFARGTSRRIAIANIVGALKEMEIKASFKSQVSYLIDLIHEPDFANNVFNTQ
WLDERIARKIKQKCTIPVSDVIAVSAAVIGHARISEVFGKFQEAIERGQVLPPNNLTETV
LFDLVRDLKIYSVKVTRSAPDSYVILLNGSNTNVNIVKFGDQGTLMATHRGSVFRCNIEE
TPEEFKVSIANQTITFEKDNDPSVLKSNVTGKFLSYKREEGEYLNVGDCYATLESMKIVF
PIEVKKAPGRLVKTAQEGDIIYPGSIIGKLVDQGDSDMYRPTQFLGTFPEWSSADNSSNE
NKVHLYNACLEKCRNILAGSVPLGGVAEVNALVTELFPNGFASGVLNSLLRDYISVEKYF
EGKGYDDSVAEIKENNTNGDAVVQTIYSHFKLKSKNVVMKAILEALKQTGSKFIPSLLDN
LREIGNLHHTEEISSLAREILLIFQNLRYKKNFTEITASGLTATVEEVKLWLNGPLAKRP
DSTGWKVIHEYFFDPEIGSQCLDRYVAMHISAHPGYMENTYTLPQMGCVISHFNLLSKPD
SFNKIVLKGNKLIVVRLSIDADAYNDCFTNPDFLDCLKKNFASYCKKDEEINVSIFVKIL
NDKSAHHDASSLTDQEEQMICYAQNAVVDIKKNLENNFKVNRVNTVLILNERPLPQLTIF
EQVRLEKDRLPANSYPVLSGLSSVRAYQQDDAESMFSKLFIRQQLIIPGNKAEDVQKKVS
EAVFLALDNACTAAQVAKAKKDKKGKERFFAANHVFVFISCPGLPKEVIASEEHLAFMKE
CITEEVENHKAILAKHQISEVEMVYESIDGHKRIVIRDETGVTTEVITEFDQSLGVYPTV
QLIDKKRFASRRVNSSYIYDFPIIFGMAAVNSWNTAKHVASLPPSMAEALHDGRWREFFT
LRELVFENGKLEQIEDSETLQKRARNALNKCGMVAWIMTLYTPEKPQGYDVVLIGNDVTF
QSGSFGTAEDDLFAAASTYSREHKLPRVNVSVNSGARIGLSTKISKLVKVQLKNEDKPDQ
GYDYIYVDGECKADVEGQVVYEELDNGRLKIVAVIGAKNEKIGVENLQGSGLIAGETSRA
YFEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQSHLILTGYEALNTLLGKKVYTSNNQLG
GPEVMFRNGVTHSVVDNDLEGIAKVLRWMSFLPTDNTSFPFFSQYGNDSNIRDVKVPVEG
DGKQYDVRDLIDSKDLTNKVGICDTMSFDEICGDWAKSIVAGRARLCGIPIGIVASEFRN
FTTTVPADPALEGSQLQNIQRAGQVWYPDSAFKTAEAINDLNKENLPLIIIASLRGFSGG
QKDMYDMVLKFGAQIVDALATYNRPVIVYIPEAGELRGGAWAVLDSKIRPEFIHLVADER
SRGGILEPNAVVGIKFREPVIAEMMKRCDQTYAELAADSKSKIQAKERFDELSKVYRNAA
VEFADAHDRWQRMKSVGAVDHVTSLKSSRRLFFELFRNELAKVGMAETYSNAPHASKPCL
ASSMTWVEENLKTFVNHSDSMDKQYKQIETYYQKQFVSDLVSAVTESKKRYEEQLSNFMA
GITRNNR
NT seq 6141 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaacggtcataaacctgatatccgaaagatcactgtcactggaaacgctctg
atcagtgacggagctgctccatacgagagtattgagcaattcgtagagcaaaatgtcaat
gacccagaaaagagaagacctattagaaagctactcgttgccaccaatggaattgctgca
gttcgttgtatgaccactatcatgagactcctgaatcacacattccgtaatgataagctt
attcatttcgtttgtatgaccactgaagatgagacgaaatccaattccgaatacctcaaa
agcgcgacaagtttggccacctccccatcgggtagcaacaagaacaactacgcgaacgtc
gacgaagttttgagacatgccaaagcagaaaaagtcgacgctgtttgggccggttgggga
cacgcttcagaaaacccagagctcccaagaagactcgctgaaaacaatattgtattcatt
ggaccaccagccagtgccatgttcagtttgggagacaaaatcgccagtactatcattgcc
caaacagtcggaattccgactatcgcttggtcgggatctggaatcaccatggagaagacc
acacgtaacaagggagactttgtggaagtaccaaagagtttgctgcaggcagcttgtgtg
aagacttaccaagaaggattggaagctctgaagactcataacattggattcccactcatg
atcaaagcttccgaaggaggaggtggtaagggaatcagaaagtgcaccaagcttgaagac
ttcaagagcatgttcgaagaagtcggacttgaagtttccaactctccaatcttcttgatg
aagtgtgttgagaacgcaagacacattgaagtccaactcatcgctgatcgctatgaaaac
gttatctctgttttcacccgtgactgttctatccaacgtcgttgccaaaaaatcattgaa
gaggctccagcttgtgttgctccaagtgagactcggaaacgtatgcaagaggacgctgtc
agaattgccagatatgttggttacgagtcagctggaactgtcgagtacttgtacttgccc
gaagatgacacctatttcttcctggaactcaacccaagacttcaagtggagcatccagcc
actgagatgatctccaatatcagcatcccagctattcagattcaaatcgctatgggactt
ccacttcacaagattccagacatccgtaatctctacaacctcccaaaggatggagattgt
gagctgccagatgaaactcttgttgatactccacttcacgcaattgctgctcgtattacc
agtgaggacccagatgacagtttccgtccatccacaggaaaagtcaaagagcttaacttc
cgttcatctcaagacgcctgggcttacttctcagtttctggaggaggacaagtgcacgaa
tacgctgattcacagtttggtcacttgttcgcacgcggaacatccagacgcattgcgatc
gcaaacattgttggcgcattgaaggagatggaaatcaaagcaagtttcaaatcgcaagtc
tcctaccttattgacttgatccacgagcctgatttcgccaacaacgttttcaacacccaa
tggttggacgaacgaattgcgagaaaaatcaaacagaaatgcactattccggtgagcgac
gtcattgctgtcagtgccgccgttatcggtcatgcacgaatcagcgaagtcttcggcaag
ttccaagaagcaatcgagagaggacaagtgttgccgccaaataaccttaccgagactgtt
ctttttgatcttgtccgtgacctaaagatctattccgtgaaggtgactcgtagtgctcct
gactcttacgtgatccttctcaatggctccaatactaacgtcaatatagtcaagtttgga
gaccaaggaaccttaatggcaactcacagaggaagcgtgttccgttgtaatattgaagaa
actcctgaggaattcaaggtcagcatcgcaaaccaaactatcacttttgaaaaggataac
gatccaagtgttctgaaatccaatgtcaccggaaagttcttgtcttacaaaagggaagag
ggagagtatcttaatgttggagactgctatgccactcttgagtcgatgaagattgtcttc
ccgattgaagtcaaaaaggctccaggaaggcttgtgaaaacggcccaagaaggagacatt
atctacccaggaagtatcattggaaaacttgtggatcaaggagactccgacatgtaccgc
ccaacacaattcctcggaacattcccagagtggtcttctgccgacaactcgtcgaacgaa
aacaaagttcatctctacaacgcttgcctggagaaatgccgcaacattctggctggatcc
gttccattaggaggggtagctgaagtcaatgctcttgtcaccgaacttttcccaaatgga
ttcgcttctggagtgctcaacagtcttcttcgtgactacatcagtgttgagaagtacttt
gaaggaaaaggatacgatgattcggttgctgaaatcaaggagaacaacacaaatggagat
gctgtggttcagaccatttattctcacttcaagttgaagtccaaaaatgttgtcatgaag
gctattctggaggcattgaagcaaactggatccaaattcattccatctcttctcgacaac
cttcgtgagattggtaacctccatcacaccgaagaaatctccagcttggctagagaaatt
cttctcatcttccaaaacttgcgctacaagaaaaacttcaccgaaatcaccgccagtgga
ctcacagctactgttgaagaagtcaaattgtggctcaatggaccgcttgccaaaagacca
gactccaccggatggaaggttatccacgagtacttcttcgacccagaaatcggatcccag
tgcttggaccgctacgtcgccatgcacatttcagctcatccaggatatatggagaacact
tacactcttccacaaatgggctgtgtaatcagtcacttcaatcttctatccaagccagat
agcttcaataaaattgtgctcaagggaaacaagctcattgttgtccgtctttccatcgac
gctgatgcttacaatgactgcttcaccaacccagatttcttggactgcctcaagaagaac
tttgcttcttactgtaagaaggatgaggagatcaacgtttccattttcgtcaaaattttg
aacgacaaatctgctcatcatgatgcttcctctcttaccgaccaagaagagcaaatgatc
tgctacgcccagaacgctgtagttgacatcaagaagaatcttgagaacaacttcaaggtc
aaccgtgtcaacactgtcttgattctcaatgaacgaccactaccacagctgactatcttt
gaacaagtccgacttgagaaggatcgtcttccagctaactcgtatccagttctctctggt
ctttcctctgttagagcttaccaacaagatgatgcagagagcatgttctccaaattgttc
atccgtcaacaactcatcattccaggaaataaggctgaggatgttcagaagaaggtatct
gaagctgtcttccttgctctcgacaacgcatgcactgctgctcaagtcgcaaaagccaag
aaggacaagaaaggaaaagaaagattcttcgctgccaaccatgtcttcgtcttcatctcc
tgcccgggattgcctaaagaagttattgcttccgaggagcatcttgctttcatgaaggaa
tgcatcaccgaggaagtcgagaatcataaggctattcttgccaaacatcaaatcagcgaa
gtggagatggtctacgaatcgattgatggtcataagagaatcgtgattcgtgatgaaact
ggagtaaccaccgaagttatcaccgagtttgaccaatctcttggagtctacccaactgtc
caactcatcgacaagaagcgtttcgcttctcgcagagtcaactcttcctacatctacgac
ttcccaattatcttcggaatggctgctgtcaattcatggaacactgctaaacatgttgct
tctctgccaccatccatggccgaagctcttcatgacggaagatggagagagttctttact
cttcgtgaacttgttttcgagaacggaaaacttgaacaaatcgaagactctgaaactctc
cagaaacgtgctagaaatgctctcaacaaatgtggaatggttgcctggattatgactttg
tatactccagaaaagccacaaggatatgacgttgttctcattggaaacgatgtgaccttc
caatcaggatccttcggaactgctgaagatgatctcttcgccgctgcttctacttactct
cgtgaacacaaacttccacgtgtcaatgtctcagtgaactctggagctcgcattggtctt
tccacaaagatctcaaagcttgtcaaagttcaattaaagaatgaagacaagccagaccaa
ggatacgattacatttacgttgatggagaatgcaaagccgatgttgagggacaagttgtt
tatgaggaattggataacggaagattgaagattgtagctgttattggagctaagaacgaa
aagattggagttgaaaacttgcaaggatctggattgattgctggagaaacctctcgtgct
tacttcgaggtcccaacatactgctacgtcaccggaagatcggtgggaatcggagcctac
actgctcgtcttgctcacagaatcgttcaacacaagcaatcccatcttatcctcaccgga
tacgaagctctcaatacccttctcggaaagaaggtctacacttccaacaaccaactcggt
ggaccagaagtcatgttccgcaacggagtcacccactctgttgttgacaatgatttggaa
ggaatcgctaaagttttgagatggatgtcgttcttgccaaccgacaacactagcttccca
ttcttctcgcaatacggaaatgattccaatattcgtgatgtcaaggtcccagttgaagga
gatggaaagcaatacgatgttcgtgacctcatcgactccaaggatctcaccaacaaggtt
ggaatctgtgacactatgtctttcgatgaaatttgcggagactgggccaagtccatcgtt
gccggaagagctagactctgtggaattccaattggaatcgttgcttctgagttccgcaac
ttcacgactactgttccagctgaccctgctcttgagggctctcaacttcagaacatccaa
cgtgccggacaggtgtggtacccagactctgcattcaagaccgctgaagctatcaatgac
ttgaacaaggaaaacctgcctctcattattatcgcttccctccgtggattctctggagga
cagaaggatatgtatgacatggtcttgaagttcggagcacagatcgttgacgcattggcc
acctacaaccgtccagtcattgtgtacatcccagaggctggagagctccgtggaggagca
tgggctgtgctcgatagcaagatccgtccagaattcattcatcttgtggctgatgagaga
tcccgtggaggtatccttgagccaaacgctgttgttggaatcaagttccgtgagccagtg
atcgccgagatgatgaagcgatgtgaccagacctacgctgagcttgctgctgattccaag
tctaagattcaagccaaggagagattcgacgagttgagcaaagtctacagaaatgctgct
gttgagtttgctgatgctcacgatagatggcaaagaatgaagtctgttggagcagtggat
catgttacctccctcaagagctctagaagattattcttcgaattgttcagaaatgagctt
gctaaagttggaatggctgagacttactccaatgctccacatgctagcaagccatgcctc
gcttcctcgatgacatgggttgaagagaatttgaagacatttgtgaatcattctgattct
atggacaagcaatacaaacaaattgaaacttattatcagaagcaattcgtgtctgattta
gtttcggcggtgacagagtccaagaaacgatacgaagaacagttgagcaatttcatggct
ggaattacgcgaaacaaccgg

DBGET integrated database retrieval system