KEGG   Caenorhabditis briggsae: CBG07699Help
Entry
CBG07699          CDS       T01054                                 

Definition
Hypothetical protein CBG07699
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cbr  Caenorhabditis briggsae
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CBG07699
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBG07699
   00640 Propanoate metabolism
    CBG07699
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CBG07699
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CBG07699
Enzymes [BR:cbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CBG07699
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CBG07699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 2047 aa AA seqDB search
MSVNGHKPDIRKITVTGNALISDGAAPYESIEQFVEQNVNDPEKRRPIRKLLVATNGIAA
VRCMTTIMRLLNHTFRNDKLIHFVCMTTEDETKSNSEYLKSATSLATSPSGSNKNNYANV
DEVLRHAKAEKVDAVWAGWGHASENPELPRRLAENNIVFIGPPASAMFSLGDKIASTIIA
QTVGIPTIAWSGSGITMEKTTRNKGDFVEVPKSLLQAACVKTYQEGLEALKTHNIGFPLM
IKASEGGGGKGIRKCTKLEDFKSMFEEVGLEVSNSPIFLMKCVENARHIEVQLIADRYEN
VISVFTRDCSIQRRCQKIIEEAPACVAPSETRKRMQEDAVRIARYVGYESAGTVEYLYLP
EDDTYFFLELNPRLQVEHPATEMISNISIPAIQIQIAMGLPLHKIPDIRNLYNLPKDGDC
ELPDETLVDTPLHAIAARITSEDPDDSFRPSTGKVKELNFRSSQDAWAYFSVSGGGQVHE
YADSQFGHLFARGTSRRIAIANIVGALKEMEIKASFKSQVSYLIDLIHEPDFANNVFNTQ
WLDERIARKIKQKCTIPVSDVIAVSAAVIGHARISEVFGKFQEAIERGQVLPPNNLTETV
LFDLVRDLKIYSVKVTRSAPDSYVILLNGSNTNVNIVKFGDQGTLMATHRGSVFRCNIEE
TPEEFKVSIANQTITFEKDNDPSVLKSNVTGKFLSYKREEGEYLNVGDCYATLESMKIVF
PIEVKKAPGRLVKTAQEGDIIYPGSIIGKLVDQGDSDMYRPTQFLGTFPEWSSADNSSNE
NKVHLYNACLEKCRNILAGSVPLGGVAEVNALVTELFPNGFASGVLNSLLRDYISVEKYF
EGKGYDDSVAEIKENNTNGDAVVQTIYSHFKLKSKNVVMKAILEALKQTGSKFIPSLLDN
LREIGNLHHTEEISSLAREILLIFQNLRYKKNFTEITASGLTATVEEVKLWLNGPLAKRP
DSTGWKVIHEYFFDPEIGSQCLDRYVAMHISAHPGYMENTYTLPQMGCVISHFNLLSKPD
SFNKIVLKGNKLIVVRLSIDADAYNDCFTNPDFLDCLKKNFASYCKKDEEINVSIFVKIL
NDKSAHHDASSLTDQEEQMICYAQNAVVDIKKNLENNFKVNRVNTVLILNERPLPQLTIF
EQVRLEKDRLPANSYPVLSGLSSVRAYQQDDAESMFSKLFIRQQLIIPGNKAEDVQKKVS
EAVFLALDNACTAAQVAKAKKDKKGKERFFAANHVFVFISCPGLPKEVIASEEHLAFMKE
CITEEVENHKAILAKHQISEVEMVYESIDGHKRIVIRDETGVTTEVITEFDQSLGVYPTV
QLIDKKRFASRRVNSSYIYDFPIIFGMAAVNSWNTAKHVASLPPSMAEALHDGRWREFFT
LRELVFENGKLEQIEDSETLQKRARNALNKCGMVAWIMTLYTPEKPQGYDVVLIGNDVTF
QSGSFGTAEDDLFAAASTYSREHKLPRVNVSVNSGARIGLSTKISKLVKVQLKNEDKPDQ
GYDYIYVDGECKADVEGQVVYEELDNGRLKIVAVIGAKNEKIGVENLQGSGLIAGETSRA
YFEVPTYCYVTGRSVGIGAYTARLAHRIVQHKQSHLILTGYEALNTLLGKKVYTSNNQLG
GPEVMFRNGVTHSVVDNDLEGIAKVLRWMSFLPTDNTSFPFFSQYGNDSNIRDVKVPVEG
DGKQYDVRDLIDSKDLTNKVGICDTMSFDEICGDWAKSIVAGRARLCGIPIGIVASEFRN
FTTTVPADPALEGSQLQNIQRAGQVWYPDSAFKTAEAINDLNKENLPLIIIASLRGFSGG
QKDMYDMVLKFGAQIVDALATYNRPVIVYIPEAGELRGGAWAVLDSKIRPEFIHLVADER
SRGGILEPNAVVGIKFREPVIAEMMKRCDQTYAELAADSKSKIQAKERFDELSKVYRNAA
VEFADAHDRWQRMKSVGAVDHVTSLKSSRRLFFELFRNELAKVGMAETYSNAPHASKPCL
ASSMTWVEENLKTFVNHSDSMDKQYKQIETYYQKQFVSDLVSAVTESKKRYEEQLSNFMA
GITRNNR
NT seq 6141 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaacggtcataaacctgatatccgaaagatcactgtcactggaaacgctctg
atcagtgacggagctgctccatacgagagtattgagcaattcgtagagcaaaatgtcaat
gacccagaaaagagaagacctattagaaagctactcgttgccaccaatggaattgctgca
gttcgttgtatgaccactatcatgagactcctgaatcacacattccgtaatgataagctt
attcatttcgtttgtatgaccactgaagatgagacgaaatccaattccgaatacctcaaa
agcgcgacaagtttggccacctccccatcgggtagcaacaagaacaactacgcgaacgtc
gacgaagttttgagacatgccaaagcagaaaaagtcgacgctgtttgggccggttgggga
cacgcttcagaaaacccagagctcccaagaagactcgctgaaaacaatattgtattcatt
ggaccaccagccagtgccatgttcagtttgggagacaaaatcgccagtactatcattgcc
caaacagtcggaattccgactatcgcttggtcgggatctggaatcaccatggagaagacc
acacgtaacaagggagactttgtggaagtaccaaagagtttgctgcaggcagcttgtgtg
aagacttaccaagaaggattggaagctctgaagactcataacattggattcccactcatg
atcaaagcttccgaaggaggaggtggtaagggaatcagaaagtgcaccaagcttgaagac
ttcaagagcatgttcgaagaagtcggacttgaagtttccaactctccaatcttcttgatg
aagtgtgttgagaacgcaagacacattgaagtccaactcatcgctgatcgctatgaaaac
gttatctctgttttcacccgtgactgttctatccaacgtcgttgccaaaaaatcattgaa
gaggctccagcttgtgttgctccaagtgagactcggaaacgtatgcaagaggacgctgtc
agaattgccagatatgttggttacgagtcagctggaactgtcgagtacttgtacttgccc
gaagatgacacctatttcttcctggaactcaacccaagacttcaagtggagcatccagcc
actgagatgatctccaatatcagcatcccagctattcagattcaaatcgctatgggactt
ccacttcacaagattccagacatccgtaatctctacaacctcccaaaggatggagattgt
gagctgccagatgaaactcttgttgatactccacttcacgcaattgctgctcgtattacc
agtgaggacccagatgacagtttccgtccatccacaggaaaagtcaaagagcttaacttc
cgttcatctcaagacgcctgggcttacttctcagtttctggaggaggacaagtgcacgaa
tacgctgattcacagtttggtcacttgttcgcacgcggaacatccagacgcattgcgatc
gcaaacattgttggcgcattgaaggagatggaaatcaaagcaagtttcaaatcgcaagtc
tcctaccttattgacttgatccacgagcctgatttcgccaacaacgttttcaacacccaa
tggttggacgaacgaattgcgagaaaaatcaaacagaaatgcactattccggtgagcgac
gtcattgctgtcagtgccgccgttatcggtcatgcacgaatcagcgaagtcttcggcaag
ttccaagaagcaatcgagagaggacaagtgttgccgccaaataaccttaccgagactgtt
ctttttgatcttgtccgtgacctaaagatctattccgtgaaggtgactcgtagtgctcct
gactcttacgtgatccttctcaatggctccaatactaacgtcaatatagtcaagtttgga
gaccaaggaaccttaatggcaactcacagaggaagcgtgttccgttgtaatattgaagaa
actcctgaggaattcaaggtcagcatcgcaaaccaaactatcacttttgaaaaggataac
gatccaagtgttctgaaatccaatgtcaccggaaagttcttgtcttacaaaagggaagag
ggagagtatcttaatgttggagactgctatgccactcttgagtcgatgaagattgtcttc
ccgattgaagtcaaaaaggctccaggaaggcttgtgaaaacggcccaagaaggagacatt
atctacccaggaagtatcattggaaaacttgtggatcaaggagactccgacatgtaccgc
ccaacacaattcctcggaacattcccagagtggtcttctgccgacaactcgtcgaacgaa
aacaaagttcatctctacaacgcttgcctggagaaatgccgcaacattctggctggatcc
gttccattaggaggggtagctgaagtcaatgctcttgtcaccgaacttttcccaaatgga
ttcgcttctggagtgctcaacagtcttcttcgtgactacatcagtgttgagaagtacttt
gaaggaaaaggatacgatgattcggttgctgaaatcaaggagaacaacacaaatggagat
gctgtggttcagaccatttattctcacttcaagttgaagtccaaaaatgttgtcatgaag
gctattctggaggcattgaagcaaactggatccaaattcattccatctcttctcgacaac
cttcgtgagattggtaacctccatcacaccgaagaaatctccagcttggctagagaaatt
cttctcatcttccaaaacttgcgctacaagaaaaacttcaccgaaatcaccgccagtgga
ctcacagctactgttgaagaagtcaaattgtggctcaatggaccgcttgccaaaagacca
gactccaccggatggaaggttatccacgagtacttcttcgacccagaaatcggatcccag
tgcttggaccgctacgtcgccatgcacatttcagctcatccaggatatatggagaacact
tacactcttccacaaatgggctgtgtaatcagtcacttcaatcttctatccaagccagat
agcttcaataaaattgtgctcaagggaaacaagctcattgttgtccgtctttccatcgac
gctgatgcttacaatgactgcttcaccaacccagatttcttggactgcctcaagaagaac
tttgcttcttactgtaagaaggatgaggagatcaacgtttccattttcgtcaaaattttg
aacgacaaatctgctcatcatgatgcttcctctcttaccgaccaagaagagcaaatgatc
tgctacgcccagaacgctgtagttgacatcaagaagaatcttgagaacaacttcaaggtc
aaccgtgtcaacactgtcttgattctcaatgaacgaccactaccacagctgactatcttt
gaacaagtccgacttgagaaggatcgtcttccagctaactcgtatccagttctctctggt
ctttcctctgttagagcttaccaacaagatgatgcagagagcatgttctccaaattgttc
atccgtcaacaactcatcattccaggaaataaggctgaggatgttcagaagaaggtatct
gaagctgtcttccttgctctcgacaacgcatgcactgctgctcaagtcgcaaaagccaag
aaggacaagaaaggaaaagaaagattcttcgctgccaaccatgtcttcgtcttcatctcc
tgcccgggattgcctaaagaagttattgcttccgaggagcatcttgctttcatgaaggaa
tgcatcaccgaggaagtcgagaatcataaggctattcttgccaaacatcaaatcagcgaa
gtggagatggtctacgaatcgattgatggtcataagagaatcgtgattcgtgatgaaact
ggagtaaccaccgaagttatcaccgagtttgaccaatctcttggagtctacccaactgtc
caactcatcgacaagaagcgtttcgcttctcgcagagtcaactcttcctacatctacgac
ttcccaattatcttcggaatggctgctgtcaattcatggaacactgctaaacatgttgct
tctctgccaccatccatggccgaagctcttcatgacggaagatggagagagttctttact
cttcgtgaacttgttttcgagaacggaaaacttgaacaaatcgaagactctgaaactctc
cagaaacgtgctagaaatgctctcaacaaatgtggaatggttgcctggattatgactttg
tatactccagaaaagccacaaggatatgacgttgttctcattggaaacgatgtgaccttc
caatcaggatccttcggaactgctgaagatgatctcttcgccgctgcttctacttactct
cgtgaacacaaacttccacgtgtcaatgtctcagtgaactctggagctcgcattggtctt
tccacaaagatctcaaagcttgtcaaagttcaattaaagaatgaagacaagccagaccaa
ggatacgattacatttacgttgatggagaatgcaaagccgatgttgagggacaagttgtt
tatgaggaattggataacggaagattgaagattgtagctgttattggagctaagaacgaa
aagattggagttgaaaacttgcaaggatctggattgattgctggagaaacctctcgtgct
tacttcgaggtcccaacatactgctacgtcaccggaagatcggtgggaatcggagcctac
actgctcgtcttgctcacagaatcgttcaacacaagcaatcccatcttatcctcaccgga
tacgaagctctcaatacccttctcggaaagaaggtctacacttccaacaaccaactcggt
ggaccagaagtcatgttccgcaacggagtcacccactctgttgttgacaatgatttggaa
ggaatcgctaaagttttgagatggatgtcgttcttgccaaccgacaacactagcttccca
ttcttctcgcaatacggaaatgattccaatattcgtgatgtcaaggtcccagttgaagga
gatggaaagcaatacgatgttcgtgacctcatcgactccaaggatctcaccaacaaggtt
ggaatctgtgacactatgtctttcgatgaaatttgcggagactgggccaagtccatcgtt
gccggaagagctagactctgtggaattccaattggaatcgttgcttctgagttccgcaac
ttcacgactactgttccagctgaccctgctcttgagggctctcaacttcagaacatccaa
cgtgccggacaggtgtggtacccagactctgcattcaagaccgctgaagctatcaatgac
ttgaacaaggaaaacctgcctctcattattatcgcttccctccgtggattctctggagga
cagaaggatatgtatgacatggtcttgaagttcggagcacagatcgttgacgcattggcc
acctacaaccgtccagtcattgtgtacatcccagaggctggagagctccgtggaggagca
tgggctgtgctcgatagcaagatccgtccagaattcattcatcttgtggctgatgagaga
tcccgtggaggtatccttgagccaaacgctgttgttggaatcaagttccgtgagccagtg
atcgccgagatgatgaagcgatgtgaccagacctacgctgagcttgctgctgattccaag
tctaagattcaagccaaggagagattcgacgagttgagcaaagtctacagaaatgctgct
gttgagtttgctgatgctcacgatagatggcaaagaatgaagtctgttggagcagtggat
catgttacctccctcaagagctctagaagattattcttcgaattgttcagaaatgagctt
gctaaagttggaatggctgagacttactccaatgctccacatgctagcaagccatgcctc
gcttcctcgatgacatgggttgaagagaatttgaagacatttgtgaatcattctgattct
atggacaagcaatacaaacaaattgaaacttattatcagaagcaattcgtgtctgattta
gtttcggcggtgacagagtccaagaaacgatacgaagaacagttgagcaatttcatggct
ggaattacgcgaaacaaccgg

DBGET integrated database retrieval system