KEGG   Caenorhabditis briggsae: CBG07714Help
Entry
CBG07714          CDS       T01054                                 

Gene name
Cbr-tbh-1
Definition
C. briggsae CBR-TBH-1 protein
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CBG07714 (Cbr-tbh-1)
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     CBG07714 (Cbr-tbh-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 585 aa AA seqDB search
MKCANAAALLFFVLCDIGVHGGEIVAELLHSNVTVKWQTDYERQTVDFSIWFGAKTPDLL
FLGFSDFGDMNSSDVLMYDNVKREIMDSYTNRDYKIIPDLSQDFQQLRRRKDHFVVRRKL
TTCDSRDYAFQRGTTQFYIAASFGYRNLVDIRDKKWILDKKFGKVIEGPTDQPSTDEGVS
SLERDVQLVIVNSNSPDPVPNVETTYECIIRKMPFDTVHKTYHIVRMEPYITPGNEHLVH
HMEVFLCRDEVEEWSGNCNDPKKPKKSKSCSHVIAAWAMGEGPIHYPREAGLPIGGKGKN
EYVMVEIHYNNPELHKGVMDTSGFQFYVTGLLRIYDAGIMELGLIYSDANSVPPNQKAWA
MNGYCPSQCTQNLPEEGINIFASQMHAHLTGRKLWTSQYRDGVQIGDVNRDEHYSPHWQH
LQQLRPMVRVMPGDTLVTTCVYDTRRRSNVTFGGYGITDEMCVNYIYYYPASEVEVCKSA
ISNSTLRAYFSQRHGMDGKTMKISDMYNGVKDWSNGVDEEFYNVLNVGNVNMNCLKSNGE
SFEFKSKDPRQGWENMARPRLFSGSFIRTRDRFQCPAINDMINFE
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtgcaaacgccgccgctctcctcttctttgtcctatgcgacattggggtccat
ggtggcgagattgttgcggaactcttgcactcaaatgtcactgtcaaatggcaaacggat
tatgaacggcaaacggtggacttctcgatttggttcggagcaaagacccctgatcttttg
ttccttggattttcagactttggagacatgaatagctcggatgttctgatgtatgacaat
gtaaaaagagaaattatggactcctatacaaatcgcgactacaaaattatccctgatctt
tcgcaagacttccaacaactccgcagaagaaaggatcatttcgtggttcggagaaagttg
acgacttgtgattccagagactacgcttttcagcgtggaaccacccaattctatatcgcc
gcatcgtttggatacagaaacttggttgatattagggacaagaaatggattttggacaag
aagtttggaaaagtgatcgagggacctactgatcagccaagtactgatgaaggtgtatcc
tctctggaaagagatgttcaattggtgattgtcaacagcaatagtcctgatccagtgcca
aatgtagaaacaacttacgaatgtatcattcgcaaaatgccatttgacactgttcataaa
acttatcacattgtccgaatggaaccatacatcacacctggaaatgagcatctggtccac
cacatggaggtcttcctctgccgagatgaagtggaggagtggagtgggaactgcaatgac
ccaaagaaaccgaaaaagtcaaagtcgtgtagtcatgttattgctgcatgggcaatggga
gaaggaccaattcattaccccagagaagccggacttccaattggaggaaagggaaagaat
gagtatgtgatggtggagattcactataacaatccagaacttcacaaaggagttatggat
acatctggatttcaattttatgttactggattgctcagaatatatgacgctggaattatg
gagcttggattgatctactctgatgccaactcagtaccaccaaatcagaaagcatgggct
atgaatggatattgtccatctcaatgcacgcagaatcttcccgaagaaggcatcaatatc
ttcgccagtcaaatgcacgctcatctaactggaagaaagctctggacctctcaataccgt
gatggtgtccaaattggagatgtcaacagagatgagcactactctccccattggcaacat
cttcagcagctccgtccaatggtccgtgtcatgccaggagacactttggtcactacttgt
gtctatgacaccagaagacgctcgaatgtcacttttggaggttacggaatcactgatgaa
atgtgcgtcaactatatttattactacccagcatcagaagttgaagtttgcaagtcggcg
atttccaacagcacattgagagcttatttttcgcaaagacatggtatggatggcaaaaca
atgaaaatctctgatatgtacaacggcgtcaaagactggagcaatggtgttgacgaggag
ttttataatgtgttgaatgtcggaaacgtaaacatgaattgcttgaaatccaacggagag
tcattcgagttcaaatcaaaagaccctcgtcaaggctgggagaatatggcaagacctcga
ctcttctccggctcgttcatcagaactagagaccgattccagtgtccagcgatcaatgac
atgatcaattttgaataa

DBGET integrated database retrieval system