KEGG   Caenorhabditis briggsae: CBG07714Help
Entry
CBG07714          CDS       T01054                                 

Gene name
Cbr-tbh-1
Definition
C. briggsae CBR-TBH-1 protein
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cbr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 585 aa AA seqDB search
MKCANAAALLFFVLCDIGVHGGEIVAELLHSNVTVKWQTDYERQTVDFSIWFGAKTPDLL
FLGFSDFGDMNSSDVLMYDNVKREIMDSYTNRDYKIIPDLSQDFQQLRRRKDHFVVRRKL
TTCDSRDYAFQRGTTQFYIAASFGYRNLVDIRDKKWILDKKFGKVIEGPTDQPSTDEGVS
SLERDVQLVIVNSNSPDPVPNVETTYECIIRKMPFDTVHKTYHIVRMEPYITPGNEHLVH
HMEVFLCRDEVEEWSGNCNDPKKPKKSKSCSHVIAAWAMGEGPIHYPREAGLPIGGKGKN
EYVMVEIHYNNPELHKGVMDTSGFQFYVTGLLRIYDAGIMELGLIYSDANSVPPNQKAWA
MNGYCPSQCTQNLPEEGINIFASQMHAHLTGRKLWTSQYRDGVQIGDVNRDEHYSPHWQH
LQQLRPMVRVMPGDTLVTTCVYDTRRRSNVTFGGYGITDEMCVNYIYYYPASEVEVCKSA
ISNSTLRAYFSQRHGMDGKTMKISDMYNGVKDWSNGVDEEFYNVLNVGNVNMNCLKSNGE
SFEFKSKDPRQGWENMARPRLFSGSFIRTRDRFQCPAINDMINFE
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtgcaaacgccgccgctctcctcttctttgtcctatgcgacattggggtccat
ggtggcgagattgttgcggaactcttgcactcaaatgtcactgtcaaatggcaaacggat
tatgaacggcaaacggtggacttctcgatttggttcggagcaaagacccctgatcttttg
ttccttggattttcagactttggagacatgaatagctcggatgttctgatgtatgacaat
gtaaaaagagaaattatggactcctatacaaatcgcgactacaaaattatccctgatctt
tcgcaagacttccaacaactccgcagaagaaaggatcatttcgtggttcggagaaagttg
acgacttgtgattccagagactacgcttttcagcgtggaaccacccaattctatatcgcc
gcatcgtttggatacagaaacttggttgatattagggacaagaaatggattttggacaag
aagtttggaaaagtgatcgagggacctactgatcagccaagtactgatgaaggtgtatcc
tctctggaaagagatgttcaattggtgattgtcaacagcaatagtcctgatccagtgcca
aatgtagaaacaacttacgaatgtatcattcgcaaaatgccatttgacactgttcataaa
acttatcacattgtccgaatggaaccatacatcacacctggaaatgagcatctggtccac
cacatggaggtcttcctctgccgagatgaagtggaggagtggagtgggaactgcaatgac
ccaaagaaaccgaaaaagtcaaagtcgtgtagtcatgttattgctgcatgggcaatggga
gaaggaccaattcattaccccagagaagccggacttccaattggaggaaagggaaagaat
gagtatgtgatggtggagattcactataacaatccagaacttcacaaaggagttatggat
acatctggatttcaattttatgttactggattgctcagaatatatgacgctggaattatg
gagcttggattgatctactctgatgccaactcagtaccaccaaatcagaaagcatgggct
atgaatggatattgtccatctcaatgcacgcagaatcttcccgaagaaggcatcaatatc
ttcgccagtcaaatgcacgctcatctaactggaagaaagctctggacctctcaataccgt
gatggtgtccaaattggagatgtcaacagagatgagcactactctccccattggcaacat
cttcagcagctccgtccaatggtccgtgtcatgccaggagacactttggtcactacttgt
gtctatgacaccagaagacgctcgaatgtcacttttggaggttacggaatcactgatgaa
atgtgcgtcaactatatttattactacccagcatcagaagttgaagtttgcaagtcggcg
atttccaacagcacattgagagcttatttttcgcaaagacatggtatggatggcaaaaca
atgaaaatctctgatatgtacaacggcgtcaaagactggagcaatggtgttgacgaggag
ttttataatgtgttgaatgtcggaaacgtaaacatgaattgcttgaaatccaacggagag
tcattcgagttcaaatcaaaagaccctcgtcaaggctgggagaatatggcaagacctcga
ctcttctccggctcgttcatcagaactagagaccgattccagtgtccagcgatcaatgac
atgatcaattttgaataa

DBGET integrated database retrieval system