KEGG   Caenorhabditis briggsae: CBG08014Help
Entry
CBG08014          CDS       T01054                                 

Definition
Hypothetical protein CBG08014
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cbr  Caenorhabditis briggsae
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cbr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 210 aa AA seqDB search
NWDDEDFEPEVSTFKREEPAPAPVVPKDVPEKKAAAPKTAAAPKKAPAFAMESLGRELTA
AEKEELQKQKDLELARDLFGDDDFEGDDSRGSYANISSKVDFEYWGERVGFLATRHKAAN
YGDMIGKLLGAITEDLTPADIQKMVTYLQQISTAKKTAEKQKAKANPAAAAPAAANNKKN
QKATLKVTKGNDNMYDDYGGADDYDDYDDY
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
aattgggacgacgaggacttcgaacccgaggtgtccaccttcaagcgagaagagccggct
ccagcgccagtggtgcctaaagatgtgcctgaaaagaaggcggcagcgccgaaaaccgcc
gcagcaccgaaaaaagcgccagcgttcgccatggaatctctcggaagagagttgacagcc
gctgagaaggaggagcttcagaagcagaaagatttggaattggctcgcgatcttttcggt
gatgacgattttgaaggagatgattccagaggaagctatgcgaatatctcatccaaagtg
gatttcgagtactggggagagcgcgtcgggtttttggctacgaggcataaggctgccaat
tatggagatatgattggaaagctgttgggtgcgattaccgaggatttaacgcctgctgat
attcagaagatggtcacctaccttcaacaaatcagtactgcaaagaagaccgcggagaag
caaaaggcgaaagccaatccagccgcggctgctccagctgctgccaacaacaagaagaac
caaaaggcgacgttgaaggtgaccaaaggtaacgacaacatgtacgacgactacggaggc
gcagatgactatgatgactatgatgattattga

DBGET integrated database retrieval system