KEGG   Caenorhabditis briggsae: CBG08063Help
Entry
CBG08063          CDS       T01054                                 

Gene name
Cbr-pfn-3
Definition
C. briggsae CBR-PFN-3 protein
Orthology
K05759  
profilin
Organism
cbr  Caenorhabditis briggsae
Brite
Exosome [BR:cbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CBG08063 (Cbr-pfn-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 125 aa AA seqDB search
MSWSDIINNNLIGSGNVSKAAILGFDGAIWAKSDNFNLATEEAIAAGKAFSALDALLGTG
LRLEGQKFLVLNADEDRVIGKQGGSGFFIKTTKAVIISIYEKGLQPEMCSKTTGALADYF
KSIGY
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtcggatattatcaataataacctaatcgggtccggtaacgttagcaaagcc
gccattcttggttttgacggggctatctgggctaagagtgataatttcaatctcgccact
gaagaagcaattgcagctggaaaagctttctccgctctggatgctcttctcggcactgga
ctccgtttggaaggacaaaagtttttggtccttaacgctgatgaggacagagtgattgga
aagcaaggtggatctgggttcttcattaaaactaccaaagctgtcatcatatcaatttac
gagaaaggactccagccagaaatgtgcagcaagaccaccggagctcttgccgattatttc
aagagcattggatactga

DBGET integrated database retrieval system