KEGG   Caenorhabditis briggsae: CBG08188Help
Entry
CBG08188          CDS       T01054                                 

Gene name
Cbr-ife-2.2
Definition
C. briggsae CBR-IFE-2.2 protein
Orthology
K03259  
translation initiation factor 4E
Organism
cbr  Caenorhabditis briggsae
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CBG08188 (Cbr-ife-2.2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CBG08188 (Cbr-ife-2.2)
Translation factors [BR:cbr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CBG08188 (Cbr-ife-2.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 226 aa AA seqDB search
MAEIAETPQKKSPLVYKLARSWSWWFLSDDRNKSWEDRLKNVHTFTGIGEFWALHDAIKP
PSGLNPSSDYNVFRDGIAPMWEVKENKNGGRWLITIEKRTSEIMDLIWTEILMAMVGEQF
KQDSESVCGMVCNVRTKGSKISVWTTDSSDDEANLRIGNVLKTVLNNASMIHQRPLFDVL
RYEDHESCQKKTSSGVKAKHSIFAVEEREEKPASVAATPAPTESTD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatcgctgaaacacctcagaaaaaatcaccactagtttacaaacttgcaaga
agttggtcttggtggtttctgtcggatgatcgaaacaaatcatgggaggacagactcaaa
aacgtacacacttttaccgggattggcgagttttgggctcttcacgatgctattaagcct
ccaagtggtttgaatccgtcatctgactacaatgttttccgtgatggaattgcaccaatg
tgggaggtgaaagaaaacaaaaatggaggtcgctggttgatcacaattgaaaaaagaaca
tcggaaataatggacttgatttggacagagattttgatggctatggttggagagcaattc
aaacaagattctgaaagtgtgtgtggaatggtttgtaatgtccgtacaaaaggctcaaaa
atatcggtatggaccaccgacagtagtgatgacgaagcaaacctccgtattggcaacgtt
ctcaagaccgtcttgaacaatgcatccatgatccaccaacgcccattgtttgatgttctt
cggtacgaagaccacgaaagctgtcaaaagaaaaccagctctggagtgaaggccaagcat
tccatttttgctgttgaggaacgcgaagagaaaccagctagcgtagctgctacaccagca
cctaccgaatccactgactaa

DBGET integrated database retrieval system