KEGG   Caenorhabditis briggsae: CBG08218Help
Entry
CBG08218          CDS       T01054                                 

Gene name
Cbr-ath-1
Definition
C. briggsae CBR-ATH-1 protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBG08218 (Cbr-ath-1)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CBG08218 (Cbr-ath-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 223 aa AA seqDB search
MSRIANGEPAVVRARGQHKGTIIFLHGLGDQGTGWADAFSTEARHDNIKAICPHSAERSV
TLNMGMRMPAWYDLFGLDATAREDADGIQAAAQYVHHLIDEEINAGIPADHIAVGGFSMG
GALAIYAGLTYPKKLGAIVGLSSFFLQRQKFPGSYTANNATPIFLGHGSQDFLVPLQIGQ
MSEGLIKQFNPNVEMHVYRGMQHSSCSEEMRDLKTFLSNHIAK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaattgcgaacggtgagccagctgtcgtgcgagcccgtggccaacacaaagga
accatcatcttccttcatggactcggagaccaaggaacagggtgggctgatgctttcagc
accgaagcccgacatgacaacatcaaagcaatctgcccacacagtgctgaacgttctgtg
actctcaacatgggaatgcgtatgcctgcttggtatgatctgttcggtctcgatgctact
gcacgtgaagatgctgatggaatccaggcagctgctcaatacgttcaccatttgattgac
gaggaaatcaatgccggtatccccgctgatcatatcgccgttggcggattctcaatgggc
ggtgctcttgccatctatgccggtctgacatatccaaagaaactaggtgccatcgttggg
cttagttcatttttcttgcaaagacagaagttcccagggagctacactgcgaacaacgcc
acacccattttccttggacatggatctcaggatttcttggttccacttcaaatcggtcag
atgtctgagggactcatcaagcagttcaatccaaatgttgagatgcatgtctacagaggg
atgcaacattccagctgttcagaggaaatgcgtgatctgaagacattcctcagcaaccac
atcgccaagtaa

DBGET integrated database retrieval system