KEGG   Caenorhabditis briggsae: CBG08401Help
Entry
CBG08401          CDS       T01054                                 

Gene name
Cbr-egl-4
Definition
C. briggsae CBR-EGL-4 protein
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     CBG08401 (Cbr-egl-4)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   CBG08401 (Cbr-egl-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 777 aa AA seqDB search
MSSTSRPSSGNSAAGGGGSGAGSGGGGGGIRGFFSKLRKPSDQVNGSQQVQVGSRTFEAH
ELQKLIPQLEEAISRKDAQLRQQQSIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQ
SAASPGQPPSPSPRTDQLGNDLQQKAVFPADGTQQRAKKIAVSAEPTNFENKPATLQHYN
KTVAAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAE
GELQVSREGATLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLG
MERHSQIINFLSKVSIFANLTEDRISKIADVMDQDYYDGGHYILRQGEKGDAFFVINSGQ
VKVTQQIEGEKEAREIRILNQGDFFGERALLGDEVRTANIIAQAPGVEVLTLDRESFTKL
IGDLDTLRKDYGDKERVATLVREPPSPVKIVDDFREEFANVTLKNVKRLATLGVGGFGRV
ELVCVNGDKSKTYALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFV
YMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLAN
SGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLG
RPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDI
RKHRWFMGFDWEGLRTKTLKPPILPKVNNPADVTNFDNYPPDNDVPPDEFSGWDEGF
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgacgagccgtccgtcgagtggcaacagtgccgctggtggcggtggaagcggt
gccggaagtggcggcggcggaggtggcattcgtggattcttctcgaaacttcggaagcct
tcggatcaggtcaacggatctcagcaggtgcaagtcggctcgcgaacgttcgaagctcac
gagctccagaagctgattccacaactcgaggaggcgatatcaaggaaagatgcgcagctt
cgacagcagcaatccatcgtcgagggacacatcaaacggatttcggagttagaaggagag
gtcaccacacttcagagagaatgcgacaagcttcgctccgttctcgagcagaaagcccag
tcggcagctagtcccggacaaccgccatcaccatcgccacgcaccgatcaacttggcaat
gatctgcagcagaaggccgtgttcccagccgacggtactcaacagcgtgccaagaagatc
gccgtgtccgcggagccgacgaattttgagaataagccagccacactgcaacactacaat
aaaactgttgccgccaagcagatgatacgcgatgccgtccagaagaacgacttcttgaag
caattggctaaggagcagatcattgagctcgtcaattgcatgtacgagatgcgtgctcgc
gccgggcaatgggtgattcaagagggagagccgggggatcgtcttttcgttgttgctgag
ggagagctacaagtgtctcgcgagggagccactctgggcaagatgcgtgctggaaccgtg
atgggagagttggccatcctctataattgtacaagaaccgcttccgttcaagctctcacc
gacgtccaattatgggttctcgatcgatcggtattccaaatgatcactcaacgattgggg
atggaaagacactcgcagattatcaatttcctttcaaaggtctcaatcttcgccaacctc
accgaggatcgtatctcaaaaatcgccgatgtcatggaccaggactactacgatggtggg
cactatatcctgagacaaggggagaagggtgacgccttctttgtgatcaattctgggcaa
gtcaaagtgacgcaacagatcgaaggagagaaggaagcgcgggagattagaattttgaat
cagggagacttcttcggagagcgtgcccttcttggagacgaagttcgaacggccaacatc
attgctcaggcgccaggcgtcgaggtccttaccctagatcgtgaatcgttcaccaagctc
atcggcgatctagataccctccggaaagactatggagacaaggaacgtgtggcgacgctg
gtccgagagccgccaagtcctgtgaagattgtcgacgattttagagaggaattcgcgaat
gtaacgctgaaaaatgtgaagcgactggcgacactgggagttggaggattcggaagagtc
gagttggtttgtgtcaatggggataagtccaaaacctacgccctgaaggcgttgaagaag
aagcatattgtggatacccgccagcaggagcatatcttcgcagagaggaatattatgatg
gagacatcaacggattggattgtgaagctttataagacgttccgtgatcaaaagtttgtc
tatatgcttcttgaagtttgccttggtggagagctctggaccacacttcgtgaccgcgga
cactttgatgattataccgcccgtttctatgtggcttgtgtgttggaaggtttggaatat
ctgcacaggaagaatattgtgtacagagacttgaagccggagaactgcctcttggctaac
tctggatacttgaaattggttgactttggattcgcgaagaagctggcgtcgggacggaag
acgtggacattctgtggaacgccagaatacgtgtcaccggaaattattctgaacaaggga
cacgaccaggctgctgactactgggcacttggaatctacatttgtgagctgatgttggga
cggccaccgttccaggctagcgatcctatgaagacgtacacgttgattctgaagggagtc
gacgcgttagagattccgaatcgacgaattggaaagacggcgacggcgttggtgaagaag
ttgtgtagagacaatccgggagagcgattgggatcgggatccggtggtgtgaacgacatt
cggaagcatcggtggttcatgggattcgattgggagggattgagaacgaagacgttgaag
ccaccaattctgccaaaggtgaacaatccagcggacgtgactaactttgacaactaccca
ccagacaacgatgttccaccagacgagttctccggatgggatgagggattctaa

DBGET integrated database retrieval system