KEGG   Caenorhabditis briggsae: CBG08529Help
Entry
CBG08529          CDS       T01054                                 

Gene name
Cbr-cyc-2.2
Definition
C. briggsae CBR-CYC-2.2 protein
Orthology
K08738  
cytochrome c
Organism
cbr  Caenorhabditis briggsae
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cbr00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 129 aa AA seqDB search
MGKKKSDSASGGAIPEGDYEKGKKIFKQRCEQCHVVNSLQTKTGPTLNGVIGRQSGQVAG
FDYSAANKNKGVVWDRQTLFEYLADPKKYIPGTKMVFAGLKKADERADLIKFIEVDAAKK
PSAYAHHLP
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagaagtccgattccgcatccggaggagcaattccagaaggcgactatgag
aaaggaaagaagatcttcaaacaacgttgcgagcaatgccacgttgtcaactcccttcaa
acaaagacaggaccaactctgaatggagtcataggaagacagtcgggacaagttgccgga
ttcgattattcagcagccaacaagaacaaaggagtcgtctgggatcgacaaacgttgttc
gagtacttggccgatccaaagaagtacattccgggaactaagatggttttcgccgggttg
aaaaaagctgacgaacgtgctgacctcatcaagttcatcgaagtggacgcagcgaagaaa
ccatcagcatatgctcaccacctaccatga

DBGET integrated database retrieval system