KEGG   Caenorhabditis briggsae: CBG08612Help
Entry
CBG08612          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG08612
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     CBG08612
Peptidases [BR:cbr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   CBG08612
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   CBG08612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
Position
V
AA seq 342 aa AA seqDB search
YFSALIQPLLLCISLLVLSIVIFLPILVYFLPHYTQFIFFLNFRRLPNTDYNDLASNNVT
SIGRSLHLPGKSGKIGVWHILPHRLSLEWRTEGKHPTESDFDDLMRDSEDKIIFYAHGNS
FDRTFYHRVEMYNLLSDRNYHVVCFDYRGYGDSEGTPTEIGIVEDARSVYEWLKEKCGKT
NIIVWGHSMGTGVSCKLVQDLSIEQQPPCGLILEAPFNNLKDAVTNHPIFTVFSWMNDFM
VDRIIIRPLNSVGLTMQSDKRIRSVSCPIIILHAEDDKILPVKLGRALYEAAKEAERDIR
YREFSSEDGLGHKFICRSPRLAEIIEEFVGSITPPSTITSSS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
tatttcagtgcacttattcaaccactgctgttatgtatttctcttctagtcctctcgatt
gtcatcttccttccaatactggtctacttccttccacattatacgcaattcatcttcttc
ctcaacttccgacgcctgccaaacaccgattacaatgatctggcatccaacaacgttacg
tctatcggaagatctcttcacttgcccggaaaaagtggaaaaattggcgtttggcacatt
ctgccacaccggttgagtttagaatggagaacagaaggaaaacacccaactgaatcagat
tttgacgatttgatgagagattcagaagacaaaatcatcttctacgcgcatggcaactcg
ttcgatagaacattctatcatcgcgtcgaaatgtacaacttgctcagtgatcggaattat
cacgtcgtctgtttcgactacaggggctacggtgattcagaaggcacaccgacagagatt
ggaatcgttgaagatgcgcgatcggtgtacgaatggttgaaggaaaaatgtgggaagacg
aatatcattgtttggggacattctatgggaactggtgtatcgtgcaaactggtccaagac
ctgtcaatagagcaacaacctccatgtggtcttatcctcgaagctccgttcaacaatctg
aaagacgccgtcacaaatcatccgatttttactgtcttcagctggatgaatgattttatg
gtggatcgaataatcattcgaccgctgaacagcgtcggtctcaccatgcaatctgataaa
cgaattagatcagtatcctgtccgatcattatcctccacgccgaggacgacaaaattctg
ccggtcaaattaggcagagcactgtacgaggcggcaaaagaagctgaacgggatatccga
tatcgagaattctcgtctgaagacggcctggggcataaattcatttgtcgttcgccccgt
ttggccgagattattgaagaattcgttgggagtataactccaccatcaactatcacatca
tcctcataa

DBGET integrated database retrieval system