KEGG   Caenorhabditis briggsae: CBG08749Help
Entry
CBG08749          CDS       T01054                                 

Definition
Hypothetical protein CBG08749
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cbr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cbr00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 899 aa AA seqDB search
MRRRRNSKKMSADDVADDWLPSTTMSGPGWKARGDRKPKEKRVPFNRPTPYQIYEALPFV
RRYFMYWMKHTFDKEKLFINTFQPLKHKPYYGVPCGGIGCGAIGRDFRGGFCKFSLRPGL
VEHKVDVVAADQFILSVRENDRCIYQKVLSAADVHRSSGQLSTWDFGFPKKNVHYRGLFP
RSWTTFRIPDLGLTVVIRQVSPVLPNNYEDTTYPVCLFLIDVENTTNDREYDVSVAFTFR
NGTGNRRWEREAECSAVMFETPEDSAEQVTGVSLYHRISGMSCTYGLASTHSKDSVLSVC
ERFDPSKSGGALWNHLMQTGDVPSLEEECAINAREMAVAVSNRFTLPPLSSKTHDYALSW
DMPKVHFGSTGRSYHRRYTRFFEASEAGSAADSLCVRALRLRHKWEEEIEKWQSPILTHD
KLPDWYKSAIFNELYFITDGGTVWFEFDENWADHEAHLSNYTKEKMKNIGRFGYLESWEY
RMVNTYDVHFYASYALAELWPELELTVQSEFTDQVYHSIEKPTRFHMEGDWANVKTASRV
PHDLGNPADEPWIATNAYVMHDTGKWKDLNMKYVLTSWRDYVVLSEEHQEFLHHTWPAVK
MIMLEALANWDQNGDGMIENFGKADQTYDAWQMEGVSAYCGSLWLASLRVSIEMAGLLED
GETKKLFLETLNKAKKVFVDVLWTGTYFRFCERSRSRETVMADQLCGYWFLQSVSPEMAD
DLLPSHMVRSALDTIYRLNVCQFGNGQMGAVNGMKPSGVVDREYIQADEMWTGVTYAVAS
LLIQQGEVEKAFHTASGSYLTCFEQTGLQYQTPEALYESKFYRAIGYMRPLSIWAMQWSL
KKHCGLNTSKERLPKLPSEHAKTSEDTVKRVETSASEDSSSLGYVSDYREEKTASTRTR
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgacgtcgtaatagcaaaaagatgtcagcagatgacgtggcagacgattggttg
ccatcgacaacaatgtcaggtcctggatggaaagcacgtggagatcgaaaaccaaaagaa
aagagggtcccttttaatagaccaactccatatcagatctacgaagctctgccatttgtt
cgtcgttactttatgtactggatgaaacacacttttgacaaggagaagctatttattaat
actttccaaccattaaagcataaaccatactatggagttccctgtggaggaattggatgt
ggagcgatcggaagagattttcgcggaggattctgcaaattcagtcttcgtccgggcctc
gtagaacacaaagttgacgtcgttgccgctgaccaatttattctctccgtgcgggaaaat
gacagatgtatctatcaaaaagtgctctccgccgccgatgttcaccgatcgtctggacaa
ctgtccacgtgggattttggattcccaaaaaagaatgtgcactacagaggattgttccca
agatcgtggaccacattcagaataccagacttgggattgactgtggttattagacaagtg
tctccagtgcttcctaacaattatgaagataccacctatcctgtttgcctttttctgatc
gatgtcgagaacactacaaacgacagagaatacgatgtttcggtagccttcacattccgc
aacggaactggaaatagaagatgggaacgagaagccgagtgttctgcggtgatgtttgag
actccagaagattctgcagaacaggtcactggagttagcctctatcatagaatctccgga
atgtcatgcacctacggattggcttcaacacacagcaaggatagtgtgctatcggtttgt
gagagattcgatccatcgaaaagtggaggagcactttggaatcatttaatgcaaaccgga
gatgttcccagcttggaggaagaatgcgctatcaacgctcgcgagatggctgtagccgtc
agcaatcgattcactcttcccccattatcgtctaaaacgcatgactacgcgttgagttgg
gatatgccaaaagtacatttcggatccactgggcgcagttatcacagaaggtacaccaga
ttcttcgaagccagtgaagctggaagtgctgcagattctctctgtgttcgtgcgttgaga
ctacgacacaaatgggaagaggagatcgagaaatggcagtcacctattctaacccatgac
aagttaccagattggtacaagtctgcgattttcaatgaactttatttcattactgatgga
ggaacagtttggtttgagtttgatgaaaattgggcggatcatgaggcacatttgagtaat
tacaccaaggagaaaatgaagaatattggaagattcgggtatctggaatcttgggaatac
cgaatggtcaatacctatgacgtccacttttatgcttcctatgctctggctgagctgtgg
cctgagctggagctcacagtccaatctgaattcaccgaccaggtttaccactctatcgaa
aaacccacccgattccatatggaaggcgattgggcaaatgtgaaaactgcttctcgcgtc
cctcacgatcttggaaacccagccgatgagccgtggattgctacaaacgcatatgttatg
catgacactggaaaatggaaggatctcaacatgaagtatgtgttaacttcgtggcgagac
tacgttgtactctctgaggagcatcaggaattcttgcatcacacgtggccagctgtcaag
atgatcatgttggaggcattggctaattgggatcaaaatggagatggaatgattgagaac
tttggaaaggcagatcaaacttatgatgcgtggcagatggaaggagttagtgcgtattgt
ggatctctttggttagcctctttgagagtatccattgaaatggcagggctattagaagat
ggagaaactaaaaaactattccttgaaactctgaacaaggcgaaaaaagtgtttgtggat
gttctctggacaggaacctattttcgtttctgtgaaagatccagaagtcgagaaactgtt
atggcagatcaactctgtggatattggttcctccaatcagtctcccctgaaatggctgat
gatcttttgccaagtcatatggtacggtctgcacttgacactatctatcgtctgaacgtt
tgccaatttggtaatggtcaaatgggagccgtgaacggtatgaaaccatctggagtcgta
gatcgagaatatattcaagctgatgagatgtggacgggcgttacatacgcggttgcttcg
cttcttattcaacaaggagaagtcgagaaggcattccatacagcatcaggaagctatttg
acgtgtttcgagcaaactgggttacaatatcagacaccggaagcactttatgaatcaaaa
ttctaccgtgcaattggttatatgcgccccctatccatttgggcaatgcaatggtcactt
aaaaagcactgcggattgaatacgagtaaagaacgattgccaaaactgccttctgaacat
gcgaagacgtcagaagacactgtgaagcgagtagaaacatcggccagtgaagatagttcg
agtctaggatacgtcagtgattatcgagaggagaagacagcgtcgacaaggacccgatga

DBGET integrated database retrieval system