KEGG   Caenorhabditis briggsae: CBG09021Help
Entry
CBG09021          CDS       T01054                                 

Gene name
Cbr-cyk-3
Definition
C. briggsae CBR-CYK-3 protein
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 1168 aa AA seqDB search
MGNTILTGRSNAIAPIISAEDARTHITEEEYRRIRQAFQRFKNGCINYDEFCYHVLGGAQ
IPEDKRRLLFSFFSHGAETISFDNLLSSLVGLCRVEEVQSRFIEEYHEFASWGLSPPKLT
IPLNDSYISFYEVMSYVTHLSVKEVIELEKVFATISDRAVCKLNVEKWKQALGGCFPDTY
AERLFAVFDENRDCQIDFRELVCTLSALCRGPHPGRISQLARIWDVDCDKLLSDEELSNM
YADLGVPVEHQTVTKSANGKAALVDFGIWAQENERYIAKYYSMALQIGHICLGLRPESKK
MELQVVNEFESRASELPLSEWNIVASGWHSEYRTLLEAERTPNPIDNSGIKGTREDSWTS
RVACISAESARLKPDLLPMDYIRVPVPLWRAWLRWHGCALTVDSQFTRKYLDGEFFEDNK
PSLELYPLEILFLGHDRKKSHDGTETTPRSLTPWACAQVSRSMTVELLALCKTELRLGDG
DARLWQVVKENEEGNVLLDDGNQNLHQLYTALGKTKKVNKMKLLLEVRERGTGVWPEELR
ASLSGKQITAASTLSSSNAQLSGRPGAVGLVNYGNFCYRNAGIQCLARVSPLTQYLLEDE
HLDELKKANTKRRDAVETTIEYAKLLREMWAAKKKNIAPNDFNDAIRMNSDMFECSEQHD
CQEFVAFLLDQLHTSMYEANKTLHPPPPAKDPKKEEENHEIEETDEEKAERSWTEYEKQN
ESLVTQLFTGQLRSRLVCRTCQSSSSVFEPFTSLSLPIGFEDVDLYQVIVVHRDGRIPRR
YGFRLSRDSKIGHLREVVAASSGISMSHITIQCMSSKGTLMSRSPNHRSSNLRDELPLSS
FPSGARLYALELPESTGEDEWRVAMHRKLQYNHEPHILGSTAGFIVSRFGLPLIVGLDEH
VTGKKLYEDVMYQMHRFMEHSVNSFSSRAHDPCEDDASGFPFTLCLVDQNYEWCGQCPAL
RFCRGCPIRPDDNKVFIPANSPIAVDWFPIALYLRYNHSEEQACEDDPSVAETWSRHFAP
SSLEHCIEKFSCPETLDAAIQCDRCEKKTTRDKVMTIWKLPKYLIIHLKRFEFLREQGRM
GKCKRTVNFPLKHFDPAPFVDKPDGNTYECIALANHYGQLSCGHFIAYAKSNEDKWLLLN
DCSVREVSEEEVDKQGAYLLFYERKDVK
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacacaatactgacaggacgctcgaatgcgattgctccgataattagtgcagaa
gacgccagaactcatataaccgaagaagagtatcgacggattcggcaggcattccagaga
tttaagaatggctgtatcaactacgatgaattttgctaccatgtcctcggaggagcacaa
attccagaagacaaacgacgtcttctgttcagcttcttctctcatggtgccgagacgatt
tctttcgataatctcctatcctcgctcgtcggattatgtagagtagaagaagtgcaatcg
agattcattgaagaatatcatgaattcgcttcgtggggattgagtccgcctaagctcacg
attccactcaacgactcctacatctcgttttatgaagtaatgtcttatgtgactcattta
tctgtaaaagaagtgatagagttggagaaggttttcgccacgatcagtgaccgcgccgtc
tgcaaattgaacgtagaaaagtggaaacaagcactcggaggatgcttcccggacacttat
gccgaaagactattcgccgtttttgatgagaatcgggattgtcaaattgacttcagggaa
cttgtctgcacactttctgcactatgtagaggtccccatcctggaaggatatcccagctc
gcaagaatctgggatgtagattgcgacaagctgctttccgatgaagagctttctaacatg
tatgccgatttgggagttcctgtggagcatcaaactgtaacgaaatcagcgaatgggaaa
gcggcactggtagattttggaatatgggcacaagagaacgaaagatacatcgctaaatac
tactcgatggctcttcaaattggacacatctgtctcggtttgaggcctgaatccaagaag
atggaacttcaagttgtcaatgaattcgaatctcgtgcatcggaactgccgctctctgaa
tggaatattgttgcatctggatggcattctgaatatcgaacattactagaagctgagaga
actccaaatcctattgacaattcaggaatcaaaggaacaagagaagacagttggaccagt
agagttgcttgtatctctgccgaatctgctcgactcaaacctgacctactccctatggac
tatatccgtgtgcctgttcctctatggagagcttggctgcgatggcacgggtgtgcgtta
acagtggattcgcaattcactcggaagtatctggatggcgaattctttgaagacaacaaa
ccctctcttgagctctatccgttagagattctctttcttggtcatgatcgcaagaaaagt
cacgatggaacggaaacaactcctcgatcattgacaccatgggcgtgtgcacaagtatct
cgaagcatgacagtggaacttttggctttgtgtaagacagaactacgattgggagatggt
gatgcacgtttatggcaagtggtcaaagagaatgaggaaggaaatgttcttctggatgat
ggaaatcaaaacttacaccagctgtatacggcactcggaaagacgaagaaagtgaataaa
atgaagttgcttctagaagtccgagaaagaggaacaggagtttggccagaggaattgaga
gcttctctttccgggaaacaaatcactgcggcttccacactatcttcttcaaatgcacag
ttgtcaggtcgtccaggagctgttggtctcgtgaattacggtaacttctgctatcgaaac
gctggaatccagtgcctcgcgagagtgtctccattgacacaatacttgctggaagatgag
catttggatgagttgaagaaggcaaatacgaaaagaagggatgctgtggagacaacgatt
gagtatgcgaagctgttgagagagatgtgggcggcgaagaagaagaacatcgctccgaac
gatttcaatgacgccatccgaatgaactcggacatgttcgagtgtagtgagcagcatgac
tgtcaggagttcgtcgcattccttctcgatcagcttcatacttcaatgtatgaagccaat
aaaactctccatcctccaccacctgcaaaagaccccaagaaagaagaggaaaatcatgaa
atagaagaaactgacgaagaaaaagcagaaagatcatggacagagtatgaaaaacagaac
gaatctcttgtcacacaactcttcaccggacagctacgctctcgtctagtctgcagaaca
tgtcaatccagttcgagcgtctttgagccatttacctcactttcgctgccaattgggttt
gaagatgtcgacttgtatcaagttattgtcgtccatcgagatggtaggattcctcgtcga
tatggtttcagactgtctcgtgactccaaaatcggacatcttcgagaagtggtagcagct
tccagtggaatatcgatgtcacatatcacgattcaatgcatgtcaagtaaaggaacattg
atgagtcgatcaccgaaccatcgaagttcgaacttgagagatgaacttccgttgagctca
ttcccgtctggagctcggctttatgcacttgagctaccggaaagtacgggagaagatgag
tggagagtggctatgcataggaagttacagtataaccatgaacctcacattctcggatcc
accgcaggctttatagtttcccgattcggactgccgttgattgttggtctagatgaacat
gtaacaggaaagaagctctacgaagacgtcatgtatcaaatgcatcgatttatggagcat
tcggtgaattccttctcgagcagagctcacgatccttgtgaggatgatgcatccggcttc
ccattcactttgtgtctcgtcgatcagaattatgagtggtgtggacagtgccctgcactc
agattctgtagaggttgtccaatccgaccggatgataacaaagtcttcattcctgcaaac
agcccaattgccgtggattggttcccgattgctctttatcttcgatacaaccattctgaa
gagcaagcgtgtgaagatgatccatcggttgctgaaacatggtcgaggcactttgcacct
agctctcttgagcactgcattgaaaagttctcttgtccggagacactcgacgccgcgatt
caatgtgatcgatgtgagaagaagacaactagagacaaggttatgacaatatggaagctt
cctaaatatctgatcatccatttgaaacgattcgagtttctccgcgagcaaggtaggatg
ggcaagtgtaagagaacagtcaacttcccactaaaacatttcgatccagctccatttgtt
gataaaccggatggcaatacttatgaatgtattgcacttgctaatcactatggtcaattg
tcatgtggtcacttcatcgcatatgcgaaaagtaacgaagacaaatggttacttctgaac
gattgttccgttagagaagtatccgaagaagaagtcgacaagcaaggtgcatatcttctg
ttctacgaaagaaaagatgtcaaataa

DBGET integrated database retrieval system