KEGG   Caenorhabditis briggsae: CBG09203Help
Entry
CBG09203          CDS       T01054                                 

Gene name
Cbr-pdi-1
Definition
C. briggsae CBR-PDI-1 protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cbr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 481 aa AA seqDB search
MSPSTSFILLLAVSIAAVSADSENVLVLTESNFEETINGNEFVLVKFYAPWCGHCKSLAP
KYDEAADILKEEGSDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQ
IVDWVKKKSGPTVTTVETAEQLNELKSKNRVVVLGYFKDAKSEAATIFNEVADSVDDIFF
AVAGSADVAASATLEADGVSLIRTDGDDSETNTIVESEITNSVTLKQWIHAYKLSPVTEF
THDSAQEIVGGDLKKFHFLIIRKSDSSFDETIAKFTEVAKLFRAKVIFVLLDVDVEENGR
ILEFLGVDAKKTPANRIVSLADQVEKFKPQDGEDYEAFTNSYLDGKSTQDLKAQDLPEDW
DSQPVKVLVASNFNEIALDESKTVFVKFYAPWCGHCKQLVPVWDELAEKYESNPNVVIAK
LDATLNELADIKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSESVSQEHEE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccatctacatccttcattttacttctcgccgtttccatcgcggcagtgagtgct
gatagcgagaacgtccttgttctcacagagagcaacttcgaagaaactatcaatggaaac
gagtttgtgttggtcaagttctatgctccatggtgtggacactgcaaatctctcgctcca
aagtacgatgaagccgccgatattctgaaagaggaaggatcggatatcaaacttgctaaa
gtcgacgccactgagaaccaggctcttgcatcgaagtttgaggtccgcggatatccaacg
attctttatttcaagagtggaaagccaacgaagtacaccggtggacgagcaactgctcaa
attgtcgattgggtcaagaagaagagtggaccaactgtcactaccgttgaaactgctgag
caactcaatgagttgaagagcaagaacagagtcgttgttctaggatatttcaaggatgct
aagtctgaagctgcaacgattttcaatgaggtcgctgattcagttgacgatatcttcttc
gctgttgccggatccgctgatgttgctgcttccgctactcttgaggctgacggagtttca
ctgattcgcaccgatggtgacgacagcgagaccaacaccatcgtagaatctgaaattacc
aactcggtcaccctcaagcaatggattcatgcttacaagctctctccagtcactgagttc
acccatgattctgctcaagaaattgttggaggagaccttaagaagttccactttttgatc
atcagaaagtctgactcttccttcgatgaaactatcgccaagttcactgaggttgccaaa
ctgttccgcgccaaggttatctttgttctccttgatgtcgacgttgaagagaatggaaga
atcctcgaattcctcggagttgatgccaagaagaccccagccaacagaatcgtcagtttg
gccgatcaagtcgagaaattcaagccacaagacggagaagactatgaggctttcactaac
agctatcttgatggaaaatctacccaagacttgaaagcccaagatcttccagaagactgg
gactcacagccagtgaaggttttggttgcatccaacttcaacgaaatcgctcttgatgaa
tcaaagactgtctttgtgaagttctatgctccatggtgcggacactgcaagcaactcgtt
ccagtttgggatgagctggctgagaaatatgagtccaatccaaacgtcgtcattgctaaa
ctcgatgccactcttaatgagctcgctgatatcaaggtcaactccttcccaacactgaaa
ctctggcctgctggatcttctaccccagtggactatgacggagatagaaacctcgaaaag
ttcgaagagttcgtcaacaagtatgctggttcagaatctgtatctcaggagcacgaagag
ctttaa

DBGET integrated database retrieval system