KEGG   Caenorhabditis briggsae: CBG09278Help
Entry
CBG09278          CDS       T01054                                 

Gene name
Cbr-pcm-1
Definition
C. briggsae CBR-PCM-1 protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CBG09278 (Cbr-pcm-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 226 aa AA seqDB search
MAWRSSGSSNAELVENLRKNGVFSNQRAYDAMKAVDRGDFASRDPYEDAPQRIGYNATIS
APHMHAAALEYLQNHLVAGANALDVGSGSGYLTVCMAIMVGQTGTVVGIEHMSELVELST
KNIKKHHSEMIENGNVVMIDGDGRQGYAEKAPYNAIHVGAAAAGVPKALTDQLADGGRMM
IPVEQEDGNQVFMQIDKINGKIHEKIVEHVIYVPLTSRDKQWSHHH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcttggagatcgagtggctcgagcaatgcggagctcgttgaaaacttgagaaaaaat
ggagtgttcagcaatcaaagagcctacgatgcaatgaaggccgttgaccgtggtgacttc
gcatccagagatccctatgaagatgctccacagagaattggatacaatgccactatttca
gcgccacatatgcacgcagctgctctcgaatacctccagaaccacctggtcgctggtgca
aatgctctcgatgtcggttcgggaagtggatatttgacagtttgcatggcaataatggtt
ggacaaacaggaactgttgttggaatcgagcacatgtcggaattggtagaattgagcaca
aagaacatcaaaaaacatcacagtgagatgatagagaatggaaacgtcgttatgattgat
ggagacggtcgtcaagggtatgcagagaaggctccatacaatgcgattcacgttggagca
gctgcggcaggagtccccaaggcgctcactgaccaactggctgacggaggaagaatgatg
ataccagtggaacaagaagacggaaatcaggtcttcatgcaaatcgataaaatcaacggg
aagattcatgagaaaatcgtggagcatgtcatctacgtaccgttgacaagccgtgacaag
caatggagtcatcatcattaa

DBGET integrated database retrieval system