KEGG   Caenorhabditis briggsae: CBG09373Help
Entry
CBG09373          CDS       T01054                                 

Gene name
Cbr-ugt-48
Definition
(RefSeq) C. briggsae CBR-UGT-48 protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00040  Pentose and glucuronate interconversions
cbr00053  Ascorbate and aldarate metabolism
cbr00830  Retinol metabolism
cbr00860  Porphyrin and chlorophyll metabolism
cbr00980  Metabolism of xenobiotics by cytochrome P450
cbr00982  Drug metabolism - cytochrome P450
cbr00983  Drug metabolism - other enzymes
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBG09373 (Cbr-ugt-48)
   00053 Ascorbate and aldarate metabolism
    CBG09373 (Cbr-ugt-48)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG09373 (Cbr-ugt-48)
   00860 Porphyrin and chlorophyll metabolism
    CBG09373 (Cbr-ugt-48)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG09373 (Cbr-ugt-48)
   00982 Drug metabolism - cytochrome P450
    CBG09373 (Cbr-ugt-48)
   00983 Drug metabolism - other enzymes
    CBG09373 (Cbr-ugt-48)
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CBG09373 (Cbr-ugt-48)
Glycosyltransferases [BR:cbr01003]
 Others
  Hydrophobic molecule
   CBG09373 (Cbr-ugt-48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C DUF3603
Motif
Other DBs
NCBI-GeneID: 8578904
NCBI-ProteinID: XP_002636909
WormBase: CBG09373
UniProt: A8X989
Position
V
AA seq 527 aa AA seqDB search
MIIRIITLLALCYSVSSHKILVFSPTASKSHMISQGRIADELANAGHEVVNFEPDFLDIT
DKFVPCKKCRRWPVTGLNNKKYKSIQNEMSANVFQESSLWSKIFNQERDSHEDEYTNLCE
EIVTKKELIEKLKAEKFDAYFGEQINLCGMGLSHILGIKHRFWVASCTMSVSMRHSLGIP
TPSSFLPFMSPLDENPASFWQRAKNFIITTAHIRDEYRDVDWTDQMFRRHFGQGFPSVDY
LAKTSDIIFVSTDELLELQSPTLANVVHIGGLGMSNKEVPLDGEFAKIMNNGKEVVLFSL
GTIANTTNLPQVIMENFLNITQKFKDYQFIVKVDKYDKRSFELGEGLENVLVTDWVPQPA
LLPHPKLKTFITHAGYNSLMEAAHAGVPVILIPFMYDQPRNGRFVAKKGWGILRDRFQLI
NDPDAIEGAIREMIQNPSYKQKASRLRKLMRTKPQNASERLIKITNWVLENDGVEELQYE
GKHLDLFTFYNLDILIVAALIPILIFIILRISDITVVVKSGTKNKKE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgattatccggataatcacacttcttgcactatgctattcagttagctctcacaaaatt
ctagttttctctccaactgcaagcaaatctcacatgatttcccaaggaagaatagcagat
gagctagccaatgcaggtcatgaagttgttaattttgaaccagactttttggatataacc
gataaattcgtaccatgtaaaaaatgcagaagatggccagttactggactgaataacaaa
aaatataaatcaattcagaatgaaatgtctgcaaacgtattccaggaatcttcactttgg
agtaaaatctttaatcaggaacgagattcacatgaagacgagtacactaatctgtgtgaa
gaaatcgtaacaaaaaaagaacttattgaaaaattgaaggctgaaaagttcgatgcctat
ttcggagaacagattaatttgtgtggaatgggattgtcgcacattttaggaataaaacac
agattctgggttgccagttgtaccatgagcgttagtatgagacacagtttgggaattcca
acaccttcaagttttcttccattcatgtctccattggatgaaaatccagcttctttctgg
cagagagctaaaaatttcattattacaactgcccatatcagagatgaatatagagatgtg
gattggactgatcaaatgttcagaagacattttggacaaggcttcccatcagttgattat
cttgcaaaaacttctgatataatttttgtttctaccgacgagttgctggaactacaatca
cctacattggcaaatgttgtccatatcggtggattgggaatgtcaaataaagaagtacct
cttgatggggaattcgcaaaaattatgaataacggaaaagaagtagttcttttctctttg
ggaaccatcgcaaacaccacaaatctccctcaagttatcatggaaaactttttgaatatt
actcaaaaattcaaagactatcaattcattgttaaagttgacaaatatgacaagagaagt
ttcgaacttggagaaggattggagaacgtattggtgaccgattgggttcctcagcctgct
cttcttcctcatccaaaactgaaaacattcataactcatgccggttataacagtttgatg
gaagcagctcatgctggagttccagttattctgattccttttatgtacgatcagccaaga
aatggaagatttgttgcaaaaaagggttggggaatattaagagatagattccaactgatc
aatgatccagatgctattgaaggagctataagagaaatgatccagaatccaagctacaaa
caaaaagcatctcgcctgaggaaactgatgagaaccaaaccacaaaatgcatctgagcgt
ctgatcaaaatcacaaattgggttttggaaaacgacggagttgaagaattacaatacgaa
ggaaaacatttggatttattcactttctacaatctcgatattctgattgttgccgcatta
attccaattttaatttttattatccttcgaatttcagatatcacagtggttgtgaaaagc
gggacaaaaaataagaaagaataa

DBGET integrated database retrieval system