KEGG   Caenorhabditis briggsae: CBG09536Help
Entry
CBG09536          CDS       T01054                                 

Gene name
Cbr-egl-3
Definition
C. briggsae CBR-EGL-3 protein
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     CBG09536 (Cbr-egl-3)
Peptidases [BR:cbr01002]
 Serine Peptidases
  Family S8: subtilisin family
   CBG09536 (Cbr-egl-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 556 aa AA seqDB search
MKNTHVDLICVFLSIIIGIGEAVDVYTNHFHVHLKEGGGLEDAHRIAKRHGFINRGQVAG
SDNEFHFVQPALVHARTRRSAGHHAKLHNDDENAEASYDFSSNDPFPYPRYTDDWFNSHG
TRCAGEIVAARDNGVCGVGVAYDGKVAGIRMLDQPYMTDLIEANSMGHEPNKIHIYSASW
GPTDDGKTVDGPRNATMRAIVKGVNEGRNGLGSIFVWASGDGGEDDDCNCDGYAASMWTI
SINSAINNGENAHYDESCSSTLASTFSNGGRNPETGVATTDLYGRCTRSHSGTSAAAPEA
AGVFALALEANPSLTWRDLQHLTVLTSSRNSLFDGRCRELPALGIKDNHRDSHGNCSHFE
WQMNGVGLEYNHLFGFGVLDAAEMVMLAMAWKTAPPRYHCTAGLIDTPHEIPADGNLVLE
IDTDGCVGTQYEVRYLEHVQAVVSFNSTRRGDTTLYLISPMGTRTMILSRRPKDDDSKDG
FTNWPFMTTHTWGENPTGKWRLVARFQGPGEHTGTIKKFELMLHGTREAPYNFIEPIVGQ
TNKKLDTVQKAHKRSH
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacacacatgtcgacctaatatgtgtgttcctgtcgattataatcggcattggt
gaggcggtcgacgtctacaccaaccatttccatgttcatttaaaagagggaggtggactg
gaagatgcgcatcggatagccaaacgacacggatttatcaatcggggacaagttgctgga
agtgataatgagttccacttcgtgcagccagctctcgttcatgcacgcaccagaagatct
gctggtcatcatgctaaacttcacaatgatgatgagaacgctgaagcttcgtatgacttc
tcatcaaacgatccattcccatatccaagatacactgatgattggttcaactctcacgga
actcgctgtgctggagaaatcgttgccgctcgtgacaacggagtctgcggagtcggagtc
gcctacgacggaaaggtcgcaggaatcagaatgttggatcaaccatacatgaccgatttg
attgaggccaactcgatgggacacgagccaaacaagatccatatctactcggcatcttgg
ggaccaacagatgacggaaagactgttgatggaccacgtaacgccaccatgcgagcaatc
gtcaagggagtgaacgagggacgtaatggtcttggatccatctttgtttgggccagtggg
gacggaggagaggatgatgattgcaactgtgatggatatgctgccagtatgtggacaatc
tcaatcaactcagccatcaacaacggcgagaacgcccactatgacgaatcctgctcttca
acacttgcttccaccttctccaacggaggacgcaatccagaaaccggagtcgccaccact
gatttgtacggaagatgcactcgttcccactcaggaacatctgctgccgctccagaagct
gccggagtctttgctcttgctctcgaagccaatccatcattgacctggagagatctccaa
cacttgaccgtccttacttccagccgtaactcgcttttcgatggaagatgccgtgagctt
ccagcactcggaatcaaggataaccacagagattctcatggaaactgctcgcatttcgaa
tggcaaatgaacggagtcggactcgagtacaatcatcttttcggatttggagttcttgat
gctgctgaaatggttatgttggctatggcctggaagactgccccaccacgttatcactgc
actgctggactcatcgacactccacatgagatcccagccgacggaaaccttgtcctcgaa
attgataccgatggatgcgttggaacccaatacgaagtccgctacttggaacatgttcag
gccgtcgtttcgttcaactctaccagacgtggagataccactctctacttgatctctcca
atgggaacccgtaccatgattctctccagaagaccgaaggatgacgattccaaggatgga
ttcaccaactggccattcatgacaactcatacgtggggagagaacccgactggaaagtgg
agactcgtcgccagattccaaggaccaggagagcataccggaaccatcaagaagttcgag
ctgatgttgcacggaacccgagaggctccatacaacttcatcgagccaatcgttggacag
accaacaagaagctcgacaccgttcagaaagctcacaagcgcagccactaa

DBGET integrated database retrieval system