KEGG   Caenorhabditis briggsae: CBG09584Help
Entry
CBG09584          CDS       T01054                                 

Definition
Hypothetical protein CBG09584
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CBG09584
    1.3.1.94  polyprenol reductase
     CBG09584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 309 aa AA seqDB search
MLENLWEVRQALPIYLLTATIGLAVSCCFTLICPHVCRLIPALTTYGKAADQLEENSLVA
RISVPKKWFKHFYALGLLTLLLCLHCIHSLIHNPDFLPTIPIKFLTILTRSYSIPPIAPS
TAVLALLLITFHVARRLYETLFVSVYSDSRMNVFHYIVGIVHYIILPISIMCETQGVITK
KEIFHVSVDDITLTQWAGAVLFWVCNWKQHQIAEQIANTRKGPRGLIRNYAYGICFGRWF
NLVSCPHFLFEICIYLSLLLVIPTAYVYRFVVLFVCVNQTFAALITHSWYHKTFPKYPKT
RKALIPYVL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaaatctatgggaagtgcgacaagcactacccatctatcttctaacggcaact
atcggacttgcagtctcttgttgttttacgttaatatgcccccatgtgtgtaggcttata
ccagcactcacaacttacggaaaagcagcagatcagttggaagagaactcgcttgtcgcc
aggatatctgtaccaaagaaatggttcaaacatttttatgcccttggtctgctaactcta
cttctttgtcttcattgcatccattcgttgattcataacccagacttccttccaacgatt
cccatcaaattcctcactatactcactagatcctacagtataccaccaattgcacccagt
accgcagttctggctctcctactcatcacctttcacgtagcacgtcgtctctatgagact
ttgttcgtcagtgtctactcggatagtcgtatgaacgtattccattacatcgttggaata
gttcattacatcattcttcctatttctatcatgtgcgaaacgcaaggagttattacaaag
aaagaaatattccatgtttctgtagatgacatcaccttgactcaatgggctggcgccgtt
cttttctgggtgtgtaactggaagcaacatcagattgccgaacaaatagccaacactcgg
aaaggtccaagaggactgattcgcaattatgcatacggtatctgtttcggaagatggttc
aatctggtctcatgccctcactttctcttcgaaatatgcatctacttatcgttgttactt
gttattccaactgcctacgtttataggtttgttgttctgtttgtttgcgtcaaccagacg
ttcgctgcattgatcactcattcctggtaccacaaaacattcccaaagtatccgaaaacc
cgcaaagctcttatcccatacgttctctga

DBGET integrated database retrieval system