KEGG   Caenorhabditis briggsae: CBG09642Help
Entry
CBG09642          CDS       T01054                                 

Gene name
Cbr-cat-4
Definition
C. briggsae CBR-CAT-4 protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbr  Caenorhabditis briggsae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 228 aa AA seqDB search
MSRIENESGFLSSDAASVGSEDDLKVDLKSDVKKTNGVNPKEDHLKSMRNAYESIIQHVG
EDIHRQGLLKTPERAAKAMMAFTKGYDDQLDELLNEAVFDEDHDEMVIVKDIEMFSLCEH
HLVPFMGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVA
VVIEASHMCMVMRGVQKINASTTTSCMLGVFRDDPKTREEFLNLINKR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcgagaacgagagtggatttttgtcttctgatgccgccagtgttggatct
gaggatgacttgaaggtggacttgaagtctgatgtcaagaagacaaacggagtgaatccc
aaggaagatcatctgaagtcaatgcgcaatgcttatgagagcattattcaacatgtcgga
gaagacattcaccgacaaggactcttgaagactccagagcgtgctgccaaagccatgatg
gcgttcaccaagggatacgacgaccaactcgatgaacttctcaatgaggctgtcttcgat
gaggatcacgatgagatggttattgtgaaagacattgaaatgttctctctttgcgaacat
catctggttccattcatgggaaaggttcacattggatacattccaaataaaaaagttctt
ggactctcaaaactcgctagaatcgttgaaatgttcagcagacgacttcaagtacaagaa
cgtttgaccaaacaaattgccactgccatggttcaagcagttcaaccatccggagtagct
gtcgttattgaggcttcccatatgtgtatggtgatgcgtggagtccaaaagatcaatgca
tcgaccacgacttcttgcatgttgggagtgttccgtgatgatccaaagacccgtgaggag
ttcctcaacctcatcaacaagcgataa

DBGET integrated database retrieval system