KEGG   Caenorhabditis briggsae: CBG09642Help
Entry
CBG09642          CDS       T01054                                 

Gene name
Cbr-cat-4
Definition
(RefSeq) C. briggsae CBR-CAT-4 protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00790  Folate biosynthesis
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CBG09642 (Cbr-cat-4)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CBG09642 (Cbr-cat-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 8579136
NCBI-ProteinID: XP_002637140
WormBase: CBG09642
UniProt: A8X8K8
Position
V
AA seq 228 aa AA seqDB search
MSRIENESGFLSSDAASVGSEDDLKVDLKSDVKKTNGVNPKEDHLKSMRNAYESIIQHVG
EDIHRQGLLKTPERAAKAMMAFTKGYDDQLDELLNEAVFDEDHDEMVIVKDIEMFSLCEH
HLVPFMGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVA
VVIEASHMCMVMRGVQKINASTTTSCMLGVFRDDPKTREEFLNLINKR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcgagaacgagagtggatttttgtcttctgatgccgccagtgttggatct
gaggatgacttgaaggtggacttgaagtctgatgtcaagaagacaaacggagtgaatccc
aaggaagatcatctgaagtcaatgcgcaatgcttatgagagcattattcaacatgtcgga
gaagacattcaccgacaaggactcttgaagactccagagcgtgctgccaaagccatgatg
gcgttcaccaagggatacgacgaccaactcgatgaacttctcaatgaggctgtcttcgat
gaggatcacgatgagatggttattgtgaaagacattgaaatgttctctctttgcgaacat
catctggttccattcatgggaaaggttcacattggatacattccaaataaaaaagttctt
ggactctcaaaactcgctagaatcgttgaaatgttcagcagacgacttcaagtacaagaa
cgtttgaccaaacaaattgccactgccatggttcaagcagttcaaccatccggagtagct
gtcgttattgaggcttcccatatgtgtatggtgatgcgtggagtccaaaagatcaatgca
tcgaccacgacttcttgcatgttgggagtgttccgtgatgatccaaagacccgtgaggag
ttcctcaacctcatcaacaagcgataa

DBGET integrated database retrieval system