KEGG   Caenorhabditis briggsae: CBG09676Help
Entry
CBG09676          CDS       T01054                                 

Gene name
Cbr-gsp-1
Definition
C. briggsae CBR-GSP-1 protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cbr  Caenorhabditis briggsae
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CBG09676 (Cbr-gsp-1)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CBG09676 (Cbr-gsp-1)
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CBG09676 (Cbr-gsp-1)
Transcription machinery [BR:cbr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CBG09676 (Cbr-gsp-1)
Spliceosome [BR:cbr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CBG09676 (Cbr-gsp-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 329 aa AA seqDB search
MSNDGDLNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLK
ICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDL
QNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSE
KKAKYQYQGMNSGRPAVGGGRPGTTAGKK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgatggcgatttaaacattgacaatttgatcactcggctcctggaagtccgt
ggatgtcgtcctggaaaaccagtaaccatgtcggaggcagagatccgcgccttgtgtcac
aaatctcgtgagattttcctgtcgcaaccaattcttctggaactcgaagcaccactcaaa
atctgcggagacattcacggacagtacaatgatcttctccgtttgttcgagtacggagga
ttcccgccagaggcaaactatctctttctcggagactatgtcgatcgtggaaagcagagt
ttggaaaccatctgcttgttgctcgcatacaaagtgaaatatccagagaactttttcctt
ctccgtggaaaccacgaatgtgcctctatcaatcgtatttacggattctacgacgagtgc
aaaagacgtttctcaatcaaattatggaagactttcaccgactgtttcaactgtctccca
attgctgcactcatagacgagaagatcttctgctgccacggaggtctctccccagatctt
caaaacatggagcagattcgccgcgtgatgcgaccgactgatgtcccagatactggattg
ttgtgcgatttgttgtggtccgatccagacaaggatgtgactggatggggagaaaacgat
agaggagtttcgttcacattcggaccagacgttgttgccaagttcttgaatcgccacgat
ttggacctaatatgcagagcacatcaagttgtggaagatggatatgagttcttcgcgaaa
agacagctcgtgacactattctctgctccgaactattgtggagaattcgacaatgccggt
ggaatgatgagcgttgatgagacgttaatgtgcagtttccagattctgaagccgtcagag
aagaaagcgaaatatcaataccaaggtatgaacagcgggcggccggccgtaggcggagga
cgacctggaacgactgctggaaaaaagtaa

DBGET integrated database retrieval system