KEGG   Caenorhabditis briggsae: CBG09676Help
Entry
CBG09676          CDS       T01054                                 

Gene name
Cbr-gsp-1
Definition
C. briggsae CBR-GSP-1 protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cbr  Caenorhabditis briggsae
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:cbr03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 329 aa AA seqDB search
MSNDGDLNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLK
ICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDL
QNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSE
KKAKYQYQGMNSGRPAVGGGRPGTTAGKK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgatggcgatttaaacattgacaatttgatcactcggctcctggaagtccgt
ggatgtcgtcctggaaaaccagtaaccatgtcggaggcagagatccgcgccttgtgtcac
aaatctcgtgagattttcctgtcgcaaccaattcttctggaactcgaagcaccactcaaa
atctgcggagacattcacggacagtacaatgatcttctccgtttgttcgagtacggagga
ttcccgccagaggcaaactatctctttctcggagactatgtcgatcgtggaaagcagagt
ttggaaaccatctgcttgttgctcgcatacaaagtgaaatatccagagaactttttcctt
ctccgtggaaaccacgaatgtgcctctatcaatcgtatttacggattctacgacgagtgc
aaaagacgtttctcaatcaaattatggaagactttcaccgactgtttcaactgtctccca
attgctgcactcatagacgagaagatcttctgctgccacggaggtctctccccagatctt
caaaacatggagcagattcgccgcgtgatgcgaccgactgatgtcccagatactggattg
ttgtgcgatttgttgtggtccgatccagacaaggatgtgactggatggggagaaaacgat
agaggagtttcgttcacattcggaccagacgttgttgccaagttcttgaatcgccacgat
ttggacctaatatgcagagcacatcaagttgtggaagatggatatgagttcttcgcgaaa
agacagctcgtgacactattctctgctccgaactattgtggagaattcgacaatgccggt
ggaatgatgagcgttgatgagacgttaatgtgcagtttccagattctgaagccgtcagag
aagaaagcgaaatatcaataccaaggtatgaacagcgggcggccggccgtaggcggagga
cgacctggaacgactgctggaaaaaagtaa

DBGET integrated database retrieval system