KEGG   Caenorhabditis briggsae: CBG09806Help
Entry
CBG09806          CDS       T01054                                 

Gene name
Cbr-chc-1
Definition
C. briggsae CBR-CHC-1 protein
Orthology
K04646  
clathrin heavy chain
Organism
cbr  Caenorhabditis briggsae
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CBG09806 (Cbr-chc-1)
   04142 Lysosome
    CBG09806 (Cbr-chc-1)
Exosome [BR:cbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   CBG09806 (Cbr-chc-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 1682 aa AA seqDB search
MAALPIKFHEHLQLPNAGIRVPNITFSNVTMESDKNIVVREMIGDQQQVVIIDLADTANP
TRRPISADSVIMHPTAKILALKSGKTLQIFNIELKAKVKAHQNVEDVVYWKWISDKLIAL
VSDTAVYHWSIEGDAAPVKMFDRHQSLAGTQIINYRADAESKWLVLIGISAKDSRVVGSM
QLYSTERKVSQPIEGHAASFVRFKVDGNQQPSNLFCFSVKTETGGKLHIIEVGTPATGNS
PFQKKNVDVPYTADTAGDFPVSMQVSTKQGIIYLVTKQGYVHLYDVESGLRIYSNRISTD
TVFVTCEYTATGGIMGINRKGQVLSVSIDEANLVPFVTNQLQNPDLALKLAVRCDLPGAE
ELFVRKFNLLFSNGQFGEAAKVAASAPQGILRTPATIQKFQQCPSTGSGPSPLLQFFGIL
LDQGKLNKYETLELCRPVLAQGRKELITKWLNEQKLECCEELGDLIKPHDVNTALSVYLR
GNVPHKVVQSFAETGQFDKIVMYAKRVGFQPDYLFQLRQILRNSNPDNGAKFAQLLVSES
ENGEPLADLSQIIDCFMEVQAVQPCTSFLLEVLKGDKPEEGHLQTRLLEMNLLAAPAVAD
AILANKMFSHYDRAAIGQLCEKAGLLQRALEHFTDLYDIKRTVVHTHLLKPDWLVGYFGS
LSVEDSLECLKAMLTQNIRQNLQVVVQIASKYHEQLGADKLIEMFETHKSYEGLFYFLGS
IVNFSQDPEVHFKYIQAATRTGQIKEVERICRESQCYDAERVKNFLKEAKLNDQLPLIIV
CDRHNMVHDLVLYLYRNQLQKYIEVFVQKVNAARLPIVVGALLDVDCSEDAIKQLIINTR
GKFDIDELVEEVEKRNRLKLLNHWLESRIQEGATDAATHNAMAKIYIDSNNNPERFLKEN
PYYDSKVVGKYCEKRDPHYAFLSYERGQCDAELINVCNENSLFKNLARYLVKRRDFTLWE
QVLNEENVYRRQLIDQVVQTALSETQDPEDISVTVKAFMAADLPNELIELLEKIVLDNSA
FSEHRNLQNLLILTAMRADRTRVMEYIQKLDNYDAPDIANIAITSELYEEAFAIFKKFDV
NSSAINVLIENVNNLDRAYEFAEKCNQSDVWASLAKAQLKQDLVKEAVDSFIKADDPGAY
MEVVNKCSQTEHWEDLVRYLQMARKKSRESYIETELVYALAKTGRLTELEEFIAGPNHAQ
IGQIGDRCFDNGMFDAAKILFNNVSNFAKLSVTLVRLGEYQGAVDAARKANSTKTWKQVC
FSCVENGEFRLAQMCGLHIVVHADELEELINFYQDRGHFEELIALLEAALGLERAHMGMF
TELAILYSKYKPEKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAALT
MMQHPTESWREQHFKEVIAKVANVELYYKAMQFYLDFKPLLLNDLLAVLSPRLDHSRTVL
FFNKLKQIPLVKPYLRQVQNLNNKAINEALNQLLIDEEDHAGLRSSIEAQDNFDNISLAQ
QLEKHPLVEFRRISAYLFKGNNRWKQSIELCKKDKLYKDAMEYAAESRNGELAEELLSFF
LDEKLYDCFAASLYHCYDLLHPDVIMELAWKHKIMDYAMPYMIQVMRDYQTRLEKLERSE
HERKEEKAEQQQNNKMTMEPQLMLTYGAPAPQMGYPGAPAGYGGQPAYGQPGQPGFNAPG
FM
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctccctattaaatttcatgagcatctgcagctccccaatgctggaattcgg
gttcccaacatcacattctccaatgtcaccatggaatctgacaaaaacattgtcgttcgt
gaaatgattggagatcaacaacaagtagtgataattgatctggcggatacagcaaatcca
actcgtcgtccgatatctgctgattctgttattatgcatccaactgcgaaaattcttgcc
cttaaatctggcaagactcttcaaattttcaacattgaattgaaagcaaaagtgaaagcc
caccagaatgtggaagatgtagtttattggaaatggattagtgataagttgatcgctctc
gtttccgacacagcagtctatcattggtcaatcgaaggagatgcagctccagttaagatg
ttcgacagacatcagtctttggccggtactcaaatcataaactaccgtgccgatgccgaa
agcaaatggctcgttcttattggtatctccgccaaagattcccgtgttgttggaagcatg
caattgtacagtacagaaagaaaggtgtcgcagccaattgaaggtcatgccgccagtttc
gtccgattcaaggttgacggaaatcaacaaccatccaacttgttctgcttctccgtgaaa
acagaaaccggaggtaaacttcacatcattgaagtcggaacccccgccactggaaattca
cctttccaaaagaagaatgttgatgttccatacacagctgatactgcgggcgatttccca
gtttctatgcaggtttcaaccaagcaaggaatcatctacttggtgacgaagcagggttac
gtccatctttacgatgtggaatctggattgcgcatctactcaaatcgtatctcgactgat
acagttttcgtcacttgcgagtacacagccactggaggaattatgggaatcaacagaaaa
ggacaagttctctcagtttcgattgatgaggctaacctggttcctttcgtcaccaaccaa
cttcaaaacccagatttggcgttgaagctagctgttcgatgtgaccttcctggtgcagag
gagttgttcgtccgtaaattcaatttgctgttcagcaacggtcaatttggtgaagctgct
aaagttgccgcttccgcacctcaaggaattctccgaactccagccactatccaaaaattc
caacagtgcccatccaccggatctggtccttcgcctcttcttcaatttttcggtattctt
ctggatcaaggaaagctgaacaagtacgaaaccttggagttgtgccgtcctgttttggct
caaggaagaaaagaactgatcaccaagtggctcaatgagcagaagcttgaatgctgcgaa
gagttaggagatctcatcaagccacacgatgtcaacactgctttatctgtctatctgcgc
ggaaatgtaccacacaaagttgttcaatccttcgctgagacaggacaatttgacaagatt
gtgatgtatgcaaagcgcgtcggattccagccagactacttgttccaactccgacaaatt
cttcgcaactcgaatccagataacggagctaagttcgctcaacttcttgtttctgagagt
gagaatggagagcctctcgctgatttgtctcagatcatcgactgcttcatggaagttcaa
gccgttcagccatgcacctccttcttgcttgaagttttgaaaggagacaagccagaggaa
ggacatcttcaaacacgacttttggagatgaatcttcttgctgctccagctgttgctgat
gctattttggccaacaagatgttctctcattatgatcgtgccgctatcggtcaactctgc
gagaaggctggtcttctgcaaagggctctcgagcatttcactgacctttatgacatcaag
agaactgtcgttcatactcatttgctcaaaccagattggctcgttggatactttggaagt
ctctccgtagaagattcattggaatgcctaaaagccatgctcactcaaaacattcgccaa
aaccttcaagtcgtcgttcaaatcgcttctaagtaccacgaacaacttggagctgataag
ctgattgagatgttcgagactcacaagtcatacgaaggtctcttctatttcctcgggtcc
atcgtcaacttcagccaagatccagaggttcacttcaagtacatccaggctgccactcgt
actggacagattaaagaagtcgagcgaatctgcagagaatctcaatgctacgatgcggaa
cgagtcaagaacttcctcaaggaagctaagctcaacgatcaactcccactgatcattgtt
tgtgaccgtcacaatatggtccatgacttggttctctacttgtacagaaaccaactacag
aagtacatcgaagtcttcgttcaaaaggtaaatgctgcccgactcccaattgttgtcgga
gctcttcttgacgtcgactgcagcgaagatgccatcaagcagctcatcatcaacacccga
ggaaagttcgatattgatgaactcgtcgaagaagttgagaaacgtaaccgactaaagctc
ttgaaccattggcttgaatcgagaatccaggagggagctactgatgctgccactcacaat
gccatggccaagatctacatcgactcgaacaacaaccccgaacgattcctgaaggagaat
ccgtactacgacagtaaggttgtcggaaaatactgcgagaagcgtgatccccactacgca
ttcctttcatacgaacgaggacagtgtgatgctgagcttattaatgtgtgcaacgaaaac
tctctgttcaagaacttggctagatatttggttaagagaagagatttcactctctgggaa
caagttctcaacgaggagaatgtctacagaagacagttgattgatcaagtcgttcaaact
gctctgtccgaaacccaagacccagaagacatttcggtgactgttaaagcttttatggct
gccgatttgccgaacgagctcattgagcttttggagaagatcgttctcgataactctgca
ttctctgagcaccgaaatcttcaaaatctgctcatcttgactgccatgagagctgacaga
acccgtgtcatggagtatattcaaaagctggataactatgatgctccagacatcgccaac
atcgccattacttcagagctttacgaggaagcctttgctattttcaagaagtttgatgtc
aactcaagtgccatcaatgttctcattgagaatgttaacaatttggacagagcttacgaa
ttcgctgagaagtgtaatcaatcagatgtgtgggcatcacttgccaaggctcaactcaaa
caagatcttgtgaaggaagctgttgattcattcatcaaggcagacgatccaggagcgtac
atggaggttgtcaacaaatgctctcaaacggaacactgggaagatcttgtccgctatctt
cagatggctcgcaagaagagccgcgagtcatacatcgagaccgaattagtttatgccctc
gcaaaaaccggacgtctcactgagttggaagagtttattgccggaccaaatcatgctcaa
attggtcagattggtgaccgttgttttgataacggaatgttcgacgctgctaagatcctc
ttcaacaacgtttcgaactttgccaagctttctgttacacttgttcgtttgggagaatac
caaggagctgttgacgctgctcgcaaggccaatagcactaagacctggaaacaagtttgc
ttctcgtgtgtggagaacggagagttccgtcttgctcaaatgtgtgggcttcatattgtt
gttcatgctgatgagctcgaagaattgatcaatttctaccaagatcgtggacactttgaa
gaactcattgctcttcttgaagctgccttgggactggaacgcgcccacatgggaatgttc
accgagcttgctatcctctactcaaaatacaagccagagaagatgcgcgagcatttggaa
ttgttctggagccgtgtcaacattccaaaggttctccgtgctgctgagcaagcccatctc
tggtctgaattggtattcttgtatgataagtacgaggagtacgacaatgctgctttgacc
atgatgcaacatccaacggaatcatggagagagcaacacttcaaggaagtcatcgccaag
gtggccaatgtagagctctactacaaagctatgcaattctacttggacttcaagccactt
ctcctcaatgatctccttgctgttctctccccaagattggatcattctcgcactgttctc
ttcttcaacaagctcaagcaaattcctctcgtcaagccatacctcagacaagtccaaaac
ttgaacaacaaggctatcaacgaagctttgaaccaattgctgattgacgaggaagaccat
gccggacttcgttcttccattgaggctcaagacaatttcgacaacatctcccttgctcaa
caactcgagaaacacccacttgtcgagttcagaagaatttcagcttacttgttcaaggga
aacaaccggtggaagcaatccatcgagctttgcaagaaagacaagttgtacaaagatgct
atggaatatgctgcagaatcgagaaatggagagcttgcggaagagcttctttccttcttc
ctcgatgaaaaactttatgactgctttgccgcctcgctttatcattgctacgacctcctc
caccctgatgtcatcatggagctcgcctggaaacacaaaatcatggactacgccatgcca
tacatgatccaagtgatgagagattatcagaccagactggagaaattggaacgttctgaa
catgagcgaaaagaggaaaaggctgagcagcaacagaacaataaaatgacgatggagcca
cagcttatgcttacgtatggtgctcctgctccacagatgggctaccctggcgctccggct
gggtacggaggacaacctgcttacggtcagcctggtcaaccaggatttaatgcccctgga
tttatgtaa

DBGET integrated database retrieval system