KEGG   Caenorhabditis briggsae: CBG09822Help
Entry
CBG09822          CDS       T01054                                 

Gene name
Cbr-apb-1
Definition
C. briggsae CBR-APB-1 protein
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
cbr  Caenorhabditis briggsae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CBG09822 (Cbr-apb-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 952 aa AA seqDB search
MTDSKYFTTTKKGEIFELKNELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQT
DNVELKKLVYLYLMNYAKSQPDLAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVEKITE
YLCDPLRRCMKDEDPYVRKTAAVCVAKLHDMNPTLVKDQGFVELLNDLLSDANPMVVANA
VAALTEMNDQQTVIEVNSQMVNKLLTALNECTEWGQVFILDALAGYTPRDERETQNICER
ISPRLAHANAAVVLSTVKVLMKLIDMMPADSDFITQLTKKLAPPMVTLLSAEPEIQYVAL
RNINLIVQKRPDILKQEMKVFFVKYNDPIYVKMEKLDIMIRLAQQNNISQVLSELKEYAT
EVDVDFVRKSVRAIGRCAIKVETSSERCVQTLLELIQTKVNYVVQEAVVVIKDIFRKYPN
RYESIISALCENLDTLDEPEARASMIWIIGEYAERIDNADELLESFVEGFHDENTQVQLQ
LLTAVVKLFLKRPGVAQALVQRVLSLATQDSDNPDLRDRGFIYWRLLSADPAAAKNVVLT
EKPLISEETDLLEPSLLEQLVCHIGTLASVYHKPPSAFIDPAKAPLRQINPIPTAKFGSS
LLDTSSATNASRNGSAPTVIPSQDQVIADLLSLDLNAPATSANTGGYGASMSGTTSMGGL
DDLLGLGGDSMPAAPAMASSNNPFDSLAGLGMPSAVPAAQQPASIGGLAEIFGSGGFGAS
SGYTHPKEMWLEASKAMGMQVEGTFVRRNGRISMEITITNRAMQAISEFALQFNKNSFGL
IPVEQMDQSPILPNQSKNFTIVCDTSGPVQVTTPLTNLQVAIKNNINAFYFATQVPLIVY
FREDGQMEKREFLEEWKSIPEQNEQQFSLQNTQNMNADAICTKLQQNNIHTVARRQVDNQ
QLLYHSVKYTNNLNVLSELKVNSQNTAITLSLKSKNLMAIANMNEVFQSLLN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactcaaagtacttcacaactactaaaaaaggtgaaatattcgaactgaaaaat
gagctcaattctgacaagaaagaaaagaaaaaggaagccgttaagaaggtcattgcaagt
atgacagttggaaaggatgttagtgctctatttccggatgtcgtcaattgtatgcaaaca
gataatgttgaactgaagaagcttgtttacttgtatctaatgaactatgccaagtcgcaa
cccgatctggccattatggcagtgaatacatttgtaaaggattgtgaagacccgaatccc
ttgatccgagcgcttgcggtccgaacaatgggatgtattcgtgttgaaaaaattaccgaa
tatctctgtgatccgttacggagatgtatgaaggatgaggatccatatgtacgaaagaca
gctgccgtttgtgttgctaaactacacgatatgaatccaactttagtcaaagatcaagga
ttcgttgagcttcttaatgatttgctttctgatgccaatcctatggtagtagccaatgct
gtcgctgctttgactgaaatgaatgatcaacaaactgtcatcgaagtcaacagtcaaatg
gtgaacaagcttctgacagctttgaacgagtgcaccgagtggggacaagttttcattttg
gatgctcttgctggatacactccacgcgacgaacgagaaactcagaacatctgcgaacgt
atctctccaagattagcccatgccaatgctgcagtcgtcctctccactgtcaaagtgctt
atgaagcttatcgatatgatgcccgctgattcggattttatcactcagctcaccaagaaa
ctagccccaccaatggtcactctgctttccgctgaacctgaaattcaatatgtggcattg
agaaacatcaacttgatcgttcaaaagcgtccggacatccttaaacaagaaatgaaagtg
ttctttgtgaaatataacgatccaatctatgtgaaaatggaaaaactcgacattatgatt
cgtctggctcaacagaacaatatctctcaagtgctgagtgaactgaaagaatacgcgact
gaagttgatgtggactttgtcagaaagtctgttcgtgcaattggacgatgcgcaatcaaa
gtggagaccagcagcgaaagatgcgttcaaacacttcttgaactcatccaaacaaaggtt
aattatgttgtgcaagaagctgttgttgtgattaaggacatcttcagaaagtatcccaat
agatacgagagcattatctctgctctttgtgagaacttagacactcttgacgagccagaa
gctcgtgcttcgatgatttggattatcggagaatacgccgagcgcatcgacaatgctgat
gaacttcttgaaagcttcgttgaaggctttcacgatgagaatactcaagtccagctccaa
ctgctcaccgccgttgtcaaacttttcctgaagagaccaggagtcgcccaggcccttgtt
caacgcgttctttctcttgctactcaggacagcgacaacccagatcttcgtgatagagga
ttcatttactggagacttctatctgctgatccagctgctgccaagaatgttgttctcact
gagaaacctttgatttcggaagagactgatcttctagagccatcccttttagagcaattg
gtttgccacatcggaacgcttgcatctgtttatcataaacctccatcagcatttatcgat
cccgcgaaggccccacttcgtcaaatcaatccgattccaactgccaaatttggttctagt
ctactggatacgtcctccgcaactaatgcgtctagaaatggatctgctcctactgtcatc
ccgtctcaagaccaggtcattgctgatctcctgtctcttgatttgaatgcacctgccacc
agtgccaacacaggaggctatggagcttcaatgtcaggaaccacctccatgggtggactt
gatgatcttcttggactgggaggtgattccatgcccgctgcacctgcgatggcttcctca
aataatccatttgattcccttgctggacttggaatgccaagtgctgttccagcagctcaa
caaccagcttccatcggtggtctcgctgaaatcttcggatctggtggtttcggagcatct
tctggctacacacacccgaaggaaatgtggcttgaagcatcgaaggctatgggaatgcaa
gttgaggggacttttgtgcgaagaaatggaagaatttccatggagattacaatcactaac
agagccatgcaagcaatttctgaatttgccctccaattcaacaaaaactcgtttggcctg
atacctgttgagcagatggatcaatctccaattcttccaaatcaatccaaaaatttcacg
atagtttgtgacacctcaggaccggttcaggtcaccacaccactcacgaatcttcaggtg
gctataaagaacaacatcaatgccttctattttgccactcaagttccactcatcgtttac
ttccgagaagatggacagatggagaagcgtgagtttttggaggagtggaagagcattcca
gagcagaacgagcaacaattctcacttcaaaacactcaaaatatgaacgcagatgcgatt
tgcacaaaattgcaacagaataacattcatacggtagctcgtcgccaagtcgataatcag
cagcttctgtaccactccgtgaaatacaccaacaatttgaatgtcctttccgagctgaaa
gttaactcgcagaacactgcaattacgctatccttgaaatccaaaaacttgatggccatc
gcaaacatgaacgaagtcttccagtcacttctcaactga

DBGET integrated database retrieval system