KEGG   Caenorhabditis briggsae: CBG09836Help
Entry
CBG09836          CDS       T01054                                 

Definition
Hypothetical protein CBG09836
Orthology
K17610  
calcineurin B homologous protein 1
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 196 aa AA seqDB search
MGQTTSQIPEHELEHLSIESGLSRGGILKLYSRFISLATHRDKTTNEYFLTKGDFQSIAE
LKQNPLGDRIIDAFFADAEVLERRKVYFKDFVKVLSHFRPINKNKPHPWNSREAKLRFAF
TMYDLNKSGTITKDEFQDILEMMIGANVPKEQVNSIADRTMREADRDGDGYITFQEFCNA
MEKTDIEQKMSFRFLT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaccacttctcaaattccggaacacgaactcgagcacttgagcattgagagt
ggattatctcgcggaggaattctgaaactgtacagccggttcatttcattggcaactcat
cgagacaagactactaatgagtatttcctcactaaaggagattttcagtctatcgcggaa
ctcaaacaaaaccctcttggagaccggataatcgacgcattcttcgctgatgctgaagtc
ctcgagcgccgtaaggtctatttcaaagactttgtaaaagtcctgagccatttccgtccg
attaacaagaacaaaccgcatccgtggaacagccgtgaagctaagttgagattcgccttt
acgatgtacgacttgaacaaaagtggcaccatcacaaaggacgagttccaggatattttg
gagatgatgatcggagcaaatgtaccaaaagagcaagtcaactcaatcgctgatcgcaca
atgcgtgaagccgacagagatggagatggatacatcacattccaggaattctgcaatgca
atggagaaaacagacattgagcagaagatgtcgttccgtttcttgacataa

DBGET integrated database retrieval system