KEGG   Caenorhabditis briggsae: CBG09948Help
Entry
CBG09948          CDS       T01054                                 

Definition
Hypothetical protein CBG09948
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CBG09948
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C67
   CBG09948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 958 aa AA seqDB search
SAGSHQFRNLLDDFMGPTQLRNSFNDLNNHGFEFLGQSNTNSSSSSNVRYTNSKNRESYL
DQNIPVGNLLDGFDFIEKPSVPYKETLVDVSDSRTKLDRDLNEEGLIVALLQRKINGLYF
KKSHEEYEEPRVFEIPAGTMVREMADDDWKIPELNEWYSKNRLNRIQERIATPMEELDCN
PRICSMVTRTDVMRISQDQAIHLLSVKPENRLELYHNIERFNFIVNLRVGNRVEVDVDDT
MRRVPAKVSWIGERQQEPGIWYNVDFDTNASQWPSNSYSSHDRLNRHFDTNWNLDMSGSS
SVAASNSRLYYSPNQMHMPMKGGGVSALYDNRRLVHYNGAEESYRNSAYPKPPPSQERII
PVTRQQAEFERPSRAMRPPEPDYNTYSNHHHPLPPAPPVAPRTSHSSSLNSYVGQPSRSK
SVHTMQRNLYHRQHIAEQNEPVESDQLGFRVEDQCIWNNNGVEERGIIKFIGFLKGHKTL
YAGVEFKNQIGAGTGVFNKEQLFHSKDGHAGFVELSTLESTSSTSSSSSSSAQHRRRLSS
SRSQQMPAASGTSISVPVNVRHNINGKQASSESLSDPPPPPYAPPSPPRASLLEKSIKGN
EKASQFQKILAQEIVFPLRKVHYVRADHVMKLRKLLAELMPHVTGLTNEEKDPEEILGFI
FSEIFHAEPFIKLIGQNRAKDSQYLVPIVVDDWQGGAATSQHLLERHMRSAQVTFAKSPP
VLIMQLPRYGQQKVFDKILPLETIDITPFVAGAVPACTSCGACSEVYCPTCFLTRRVFYS
EIIFCRKCFHHSHLLPEIQDHQSRDLFPPAKPVKKPHSHKMVLSAVLCIETSHYVAYVRS
STNQWIFFDSMADREGLSDGFNVPVARECGNMSDWLSLQGWNRLKDADETGQIKVIGVFF
LFSQVIIDFFQAMFGKAALDPLVGRLLSDSYICFYEDASATCPSSSSNLISTFKNMMN
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
tcagcgggctctcatcaatttcgcaatctgttggacgacttcatggggccaactcaactc
agaaatagtttcaatgacctgaataatcacggtttcgagtttctgggacaatccaataca
aattcaagttcaagttcaaatgttagatatacaaatagtaaaaaccgagaatcatacctt
gatcaaaatataccggtcggaaatttgttagacggattcgatttcatagaaaagccttcc
gtgccttataaggaaactctagtggatgttagcgacagtaggacaaagctagatcgagat
ctgaatgaagagggattaatagtggcacttcttcaaaggaaaatcaatggtctttatttc
aaaaagagccacgaggagtatgaagagccgagagtttttgaaattccagctggaacaatg
gttcgagaaatggctgatgacgactggaagatacccgaactgaacgaatggtactcgaaa
aataggttgaatcgtatacaagaaagaatagctacaccaatggaggaactcgattgtaat
ccaaggatatgttccatggtgacaaggacggatgtgatgcgaataagtcaggatcaggca
atacatcttctgtctgtgaagcctgagaatcgactggaactataccacaatatcgaaaga
ttcaattttattgttaacctgagagttggaaaccgagtggaagttgatgtcgacgacaca
atgcgcagagttccagcaaaagtctcatggatcggagagagacaacaagaaccgggaata
tggtacaacgtcgacttcgacacgaacgcttctcagtggccatcaaattcatactcatct
catgaccggttaaatcgacactttgacacaaattggaacttagacatgtctggatcgtca
tcggtggcagcttcgaattcacgtctctattactctcccaaccaaatgcacatgccgatg
aaaggcggcggagtgtcagcactctacgataatagacgactggtgcattataacggagca
gaggaaagctaccgaaattctgcttatccaaaaccaccaccctcacaggaaagaataatt
ccggtgacgaggcaacaagcggaatttgaacgacctagcagagcgatgagacctccggag
ccggactacaatacatattcaaatcatcatcacccacttccaccagcaccaccagtggca
cctcgtacatctcactcctccagcttgaattcatacgtaggacagcctagtcggagtaaa
agtgttcacacaatgcaaagaaacttatatcatagacaacacatagcagagcaaaatgaa
cctgtggaaagtgatcagctgggtttccgagttgaggatcaatgtatttggaacaataat
ggagtagaagaacgaggaataatcaagttcattggatttttgaaaggacacaaaacgcta
tatgctggtgttgaatttaaaaatcaaattggagcaggaactggagttttcaacaaggaa
caactattccattcaaaagacggacatgctggattcgttgaactctcaacactcgagtca
acgtcttccacttcatcaagttcttcttcttctgcacaacatcgacgtcgtctttcttct
tcgcggagtcaacagatgcctgctgcgtctgggacatcaatcagcgttccagtcaatgtg
cggcacaacattaatgggaaacaagcttcgtcagaatctctttctgatccaccaccacca
ccatacgccccaccatcgccgccacgagcttccctcctcgaaaaatcaatcaaaggaaat
gagaaagcttcccagtttcagaaaattttggctcaagaaattgtattcccactgagaaaa
gtgcattatgtgagagctgaccatgtgatgaagcttcgaaagctgctcgccgaacttatg
ccacatgtcacaggattgacgaatgaagaaaaagacccagaagagatattgggattcatt
ttctcagagattttccatgcggagccattcatcaaactaattggacagaatcgtgcgaag
gattctcaatatcttgttccgattgttgtggacgattggcaaggaggggctgcaacatcc
cagcatctacttgaaagacatatgcgttctgctcaagtaactttcgcaaaatcacctcca
gttctgataatgcaacttccgagatatggacaacaaaaagtattcgataagattctacct
cttgagaccatcgatatcactccgtttgttgctggagctgttcctgcctgtacaagttgt
ggggcatgctcggaagtttattgtccaacgtgttttttgactagaagagtattctattcg
gaaatcatcttctgtcggaagtgtttccatcactctcatctcttgccagaaatccaagac
catcagagccgtgacctattcccaccagccaaaccagtcaagaagccacattcgcacaaa
atggtcctatcagcagtactttgcattgaaacatctcactatgttgcatacgtacgatca
tctacaaatcaatggattttcttcgattcgatggctgatcgagaaggattatcggatgga
tttaatgttccagttgccagagaatgtggaaatatgtcagattggttatctctacaagga
tggaatcggttgaaggatgcagatgaaacagggcagattaaggtgattggagtttttttt
ctattttcacaagtaattatcgactttttccaggcaatgttcggaaaggcagcattggat
ccgctggtcggacgccttctctcggacagctacatatgtttctacgaagatgcttctgca
acctgtccatcctcatcttcgaatttgattagtacttttaagaatatgatgaattag

DBGET integrated database retrieval system