KEGG   Caenorhabditis briggsae: CBG09974Help
Entry
CBG09974          CDS       T01054                                 

Gene name
Cbr-cbp-1
Definition
C. briggsae CBR-CBP-1 protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cbr  Caenorhabditis briggsae
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    CBG09974 (Cbr-cbp-1)
   04330 Notch signaling pathway
    CBG09974 (Cbr-cbp-1)
   04350 TGF-beta signaling pathway
    CBG09974 (Cbr-cbp-1)
   04630 Jak-STAT signaling pathway
    CBG09974 (Cbr-cbp-1)
   04068 FoxO signaling pathway
    CBG09974 (Cbr-cbp-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CBG09974 (Cbr-cbp-1)
Transcription factors [BR:cbr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    CBG09974 (Cbr-cbp-1)
Mitochondrial biogenesis [BR:cbr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    CBG09974 (Cbr-cbp-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 2022 aa AA seqDB search
MDEPPSKKSRADSEYDSGLDALSALDNLEPLPTSSKETDVDNPSTSAGGSAGPSGSTPQQ
HPPQQGTPQPSQSGSVGFNLQPGQPGVQQQQQPQTMGGGANGSVLQELLMNPSQASNNSP
RPPGYPTGQQNAFSRSPMMSNGTPNMMSPPNMGGRVPGPSPGGPQQVPGQPQMRPGQQGM
YPPGGDQQMMMGAQGQQFPGMMPRYPQYAQTGPPGAQGIPQPGYPGAGRGGPNPGQQMGR
GGMMNGTMGRNGPMAPQGRPGMPPNQQQMMQPMMDRQFMQHSQYGQQRPEFMQQYGRGPA
SGYPMMHPQHQQQMMMEANGRPPHMMMMNNGHPGMGHVPPTGPGAQAAAAQHAAQQAAAA
QAAAAQQHQQQQQQQQQRDQDAQRNGAARATTPGSSMLATHQDPEKRKLIQQQLVLLLHA
HKCSQREKENRDYAAKNQPPPHAPCTLPHCSTMKDVLSHMTSCNVGRLCPSDTTQTTKKC
SVAHCASSRQIIAHWKNCSREDCPVCKPLKRIQDTPLQFSLPDLANLIGVNGNSNGSAEG
DGLSQFGSPSMRSGQIPNSLFEGFHGDPFQRNGNRGAQRPGGSNGEIPNLPPPDMPDCTK
EWHHQVTKDLRNHLVGKLVKAIFPEPDPGAMNDNRLKDLIAYARKVEKEMFESANDREEY
YHLLAEKIYKIQKELQEKKNSRLSTQGAAPHDPYNNIPPSNELAQMLGVEGGRSNDVHMD
GSMGAPSQQHTPWGGAPNSNVQNMPNGQIPPLNNGSTFPQSGSSTPNMGAPSTTGGLLQP
KLEPMDENVDSMSSRPTTAAGFGGGSSSSTPAPMLNGIVIKKEEDSMDETSNQAPESVKD
VKPSEKPSEPQVKREPTPPLAEDTVFTQEDLIKFLSPVWETLDKAEDAAPFRAPVDAKLL
NIPDYHDIIKRPMDLETIHKKLHSGQYQNAFQFVDDIWLMFDNAWLYNRKNSKVYKFGIK
LSELFVAEMDPVMKVMGYCCAKKLAFTPLSLFCYGAAMCTIAREQQYWVYEQSSTQYNVT
VTERYTYCQKCFDALPPEGISLSENPNDRTNMAPKTAFKDMKNNNVDYEPFERCKYCMRK
WHRICALHDKKVYPEGFICECCRTAKKYQKPENKYLASKLPHNQLSTFLEDRVNGFIKKQ
LQAEAHKYPVIIRTLCVQDKEAEVKPQMKQKYVESGQFPEKFPYRTKAVFAFEIIDGVEV
CFFGLHVQEYGSDCPAPNARRVYIAYLDSVHFFQPRELRTDVYHEILLGYLDYAKKLGYT
MAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQAR
DDNLVTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDDDDGDDADGGLGGSDSGKK
KSTKNKKNNLKKTTKMNKKKAGSLTGNEVADKLFSQFEKHKEVFFTIRLVSLKDEPTVLA
TGINDPDGLMPSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHEADSKGMEYT
CNKCNGPATWHCQTCDDFDLCDRCKPSVSHPHELEKMKNLMTGEGPESASSGSRYESIQR
CIASLVHACQCRDANCRRMSCHKMKRVVQHTKLCKKRISGTCPVCKQLIALCCYHAKHCN
RDGCTVPFCMNIRQKLAEQKRSQQRRADMMMRRRMEGLHSLVGGGPVPPTPSVPTNNAAV
PTNVPTPPTNAAAPGQPGPAVKGGGVGQAQPQQQQGGPMSAGTPNGIGQSLGFGGGLGMP
SGGPSSAQNGPLPGNNPPSIGGQNQGRFMPNGQGFGQGQPSGGQQGIYPGMQRPGMGHGG
LGGMNQTQPQQMPGQAGLSGQQQPGRPGIPGIGQNPQFRPNQDMYNMMNMPQGQQQPQQP
IDNTLAPQITKINARLKAAKTNQEREMVFSDLKKTPHLFHAWLRVHGNSGQYNPMMAQQM
QGVPPMQMGQNPQQQQMQQQQANMRVGANFAAGPNQPRGPGGQFASMNPSMSQHGQQQPG
GWPQQRQQNPGMPQNNMPFNQFQNRQQMMMMQQQQSHPSNAG
NT seq 6066 nt NT seq  +upstreamnt  +downstreamnt
atggatgagccaccatcaaaaaaatctcgcgcggatagcgagtacgattcgggattagat
gctctcagtgctcttgacaatctagagcctctgccgacatcaagcaaagaaacagatgta
gacaatccaagcacatcagctggtggatcagcaggtccttctggctcgacacctcagcaa
catccaccacaacaagggacaccacagccttctcaatcaggcagtgttggcttcaatctt
cagcctgggcaaccaggagttcagcaacaacaacaaccacagaccatgggtgggggcgcc
aatggaagtgtgttacaggaactgctgatgaatccatcacaagcatcaaataattcacct
cgacctcctggatatccaacgggacagcagaatgcgtttagtaggagtccaatgatgtca
aacggtacaccaaacatgatgtcgccaccgaatatgggtggccgggtaccagggccaagt
ccaggagggcctcaacaagttcctggacaaccacagatgcgaccagggcagcaaggaatg
tatccacctgggggagatcaacagatgatgatgggagcacaaggacaacaatttccagga
atgatgcctaggtacccccaatacgcacagactggaccaccaggagcacagggaatccct
caaccaggttatccaggagcaggtcggggcggaccgaatccaggacaacaaatgggacgg
ggaggaatgatgaatggaacgatgggacgaaacggtccaatggcacctcaaggaagacct
ggaatgccgcctaatcagcaacaaatgatgcagccaatgatggatcgacagttcatgcaa
cattcgcagtacggtcagcaaaggccagagttcatgcagcaatatggtcgaggtccagct
tccggatatccaatgatgcatccgcaacatcaacaacagatgatgatggaagcgaatggt
cgtccaccccacatgatgatgatgaacaatggtcatcctggaatgggacatgtgccacca
actggtccaggagctcaagctgctgctgctcaacacgcagctcagcaagcggctgctgcg
caagctgctgcagctcaacaacatcagcagcaacaacaacagcaacagcaacgtgatcag
gatgcacagaggaacggtgcggctcgagcaacaacacccggatcgagcatgctcgcgact
catcaggatcctgagaagaggaagctaattcagcaacaattggttttgttactccatgca
cacaaatgctctcagagagaaaaagagaatcgagactatgctgctaagaatcaacctcct
ccacacgctccgtgcacactgccacattgctccacaatgaaagatgttctatcgcacatg
acaagttgtaatgtcggacgattatgtccttccgataccacacaaacaacaaaaaaatgt
tcagttgcccattgtgcttcatctcgtcaaataattgctcactggaagaattgttctaga
gaagactgtccggtttgtaaaccgttgaagaggatacaagatacacctttgcaattctca
ttgcccgatctggccaacttgatcggagtcaatggaaactcgaacggaagtgcagagggt
gacgggctgtcgcaatttggttctccttctatgcgctctggacagatacctaattcactc
ttcgaaggattccatggagatccattccaacggaacggcaatcgcggtgcacaacggcca
ggcggcagcaatggagagattcctaacttacctccaccggatatgccggattgtacaaag
gaatggcatcatcaagttaccaaagatcttcggaaccatttggttggaaagttggtgaag
gcgatattcccagagcctgacccaggagcaatgaatgacaatcgcctgaaggacttgatc
gcttatgccagaaaggtcgagaaggagatgttcgaatcagcaaacgaccgtgaagaatac
tatcatttactggcagagaagatttataaaatccaaaaagaacttcaggagaagaagaac
tctcgactgtcgactcaaggagcagctcctcatgatccgtacaacaacattccaccatcc
aacgagctcgctcagatgcttggtgttgaaggaggacgcagcaatgacgttcatatggat
ggtagtatgggagcgccaagccaacagcatacaccatggggaggagctccaaattctaac
gtgcagaacatgccaaacggtcaaatccctccgctcaacaatggatctactttcccacag
agtggaagcagcacaccaaacatgggagccccgtctaccaccggtggccttcttcagccg
aaacttgagccaatggatgagaatgttgattcgatgagctccagaccaaccaccgcagcc
ggctttggtggaggatccagttcatcaactccagcgccaatgcttaacggtatcgtgatt
aaaaaggaagaagattcaatggatgagacatctaatcaagctccagaatcagtgaaggat
gtcaagccttcagagaagccatctgaaccacaagtgaagagagaaccgacaccaccacta
gccgaagatactgttttcacgcaggaagatcttataaagttcttgtcgccagtttgggag
actctggacaaagcagaagacgctgctccattccgtgctccagtcgatgcgaagcttctc
aatattccggactaccacgatatcattaagcgtccaatggacctggaaacgatccacaag
aagcttcattccggtcaatatcagaatgcatttcaatttgttgacgatatatggctgatg
tttgataacgcttggctttacaacagaaagaacagcaaagtgtacaaattcggaatcaag
ctgtctgaattattcgtcgctgaaatggatccagttatgaaagtcatgggttactgttgc
gccaagaaacttgccttcactccactttcgttgttctgttatggtgctgccatgtgtacg
atagcaagagaacaacaatactgggtttacgagcagagttcaacacagtataatgtcaca
gtcaccgagagatacacctattgccagaagtgcttcgatgcgttaccacctgaaggaata
tcactctctgaaaatccaaacgaccgaacgaatatggctccgaaaacggcgttcaaggat
atgaagaacaacaacgtcgactacgaaccattcgaacggtgcaagtattgtatgcggaaa
tggcatcgtatttgtgctctccacgataagaaggtgtatccagaaggatttatatgcgag
tgctgtcggactgcaaagaaataccaaaaaccggagaataaatatctggctagcaaactt
ccacataaccagctatctacattcctcgaagatcgtgtcaatggttttataaagaagcag
ttgcaagcggaggcacacaagtatccagtcataatcagaactctctgcgttcaagataaa
gaagctgaagtgaaaccgcagatgaagcaaaagtatgtggagagtggacagtttcctgag
aagttcccataccggaccaaggccgtttttgcattcgagatcattgatggagttgaagtt
tgcttctttggtcttcatgttcaagaatatggaagcgattgtccagctccaaacgctcga
agagtttacattgcttatctcgattctgttcatttcttccaacctcgcgagttgcgtaca
gatgtctaccacgagatccttcttggatatcttgattacgccaagaagctgggatacacg
atggctcacatttgggcgtgtcctccatcggaaggtgatgactacatcttccattgccat
ccaccagagcagaagattccaaagccgaaacgtcttcaggattggtacaaaaagatgttg
gagaagggagtgcaagaaggaagtgtcgtggaattcaaggatatatacaagcaagctaga
gatgataatcttgtcacacctactcaacttccatacttcgaaggagatttctggccaaat
gtaatagaagattgtatacgggaagcgtcgaatgaagaagctcagcgtaaggtgaaggaa
gatgatgacgatggcgacgatgcagatggaggccttggtggaagtgacagtggcaagaag
aagagcacgaagaacaagaagaacaacttgaaaaagaccaccaagatgaacaagaaaaag
gctggaagtctcacagggaacgaagtcgctgacaaacttttctcgcagtttgaaaaacac
aaggaagtgttcttcaccatcagacttgtcagcttgaaagacgaaccaactgtcctcgct
actggaataaacgatcctgatggtttgatgccttcggatatgatggacggtcgtgatacg
ttccttaccaaggctagagaagaacattgggagttttcgtctttaagaagagctaaatat
tcgacgttatgccttgcatactctcttcatgaagccgactcaaagggaatggagtacaca
tgtaacaagtgtaatggaccagcaacgtggcactgtcaaacttgtgatgacttcgatttg
tgtgatagatgcaagccaagcgtctcacatcctcatgaattggaaaagatgaagaatctg
atgacaggagaaggtccagaaagtgcttcaagtggatctcgctacgaaagcattcagaga
tgtatcgcatcgcttgttcatgcttgccaatgccgtgatgccaactgtaggcggatgtcg
tgccacaagatgaagcgtgtcgttcagcatacgaagttgtgcaagaagaggatcagtgga
acatgtccagtttgcaaacagttgattgccctctgctgttatcacgccaaacactgcaac
cgagatggatgtactgttccattctgtatgaacatccgccagaaacttgccgaacaaaaa
cgatcacaacaacgacgagctgacatgatgatgaggagaagaatggaaggacttcattca
cttgttggaggaggacccgtcccaccaactccaagtgttcctaccaataatgccgctgtc
cccaccaatgtaccaacaccgccaacgaatgccgcagctcctgggcagcctggacctgca
gtgaaaggaggaggcgttggccaagcccaaccacaacaacaacaaggaggtccgatgagt
gctggaactcctaatggaatcggccaatcgttaggtttcggaggaggattaggaatgccc
agtggaggtcctagctcagcccaaaacggaccactccctggaaacaacccaccatccatt
ggaggacagaatcaaggtcgtttcatgccaaatggtcaaggattcggacaaggtcaacca
tcaggaggacaacaaggcatctacccaggaatgcagcgaccaggaatgggtcacggaggt
ctcggaggaatgaaccagactcaaccacagcagatgcctggacaggctggtctttctgga
caacaacagccaggccgtcctggaattcccggaatcggccagaatccacaattcaggccc
aaccaggatatgtacaacatgatgaacatgccgcaaggccagcaacaaccacaacaaccg
atcgataatacgttggcaccgcaaataacgaagatcaacgctcgattaaaggcagcgaag
accaatcaagaacgagaaatggtattttctgatttgaagaagactccgcatttatttcat
gcttggttgagggttcacggaaacagcggacagtacaatccaatgatggctcaacagatg
caaggtgttcctccgatgcaaatgggacaaaaccctcaacagcaacaaatgcaacaacag
caagctaacatgcgtgttggcgcaaactttgctgcgggaccgaatcagccacgaggccct
ggaggccagttcgcatcgatgaacccatcaatgtctcagcatggacaacagcaaccagga
ggatggccacaacaacggcaacagaatcctggaatgcctcagaataacatgccgttcaac
cagttccagaatcgacagcagatgatgatgatgcaacaacaacagtctcatccatcgaat
gccggc

DBGET integrated database retrieval system