KEGG   Caenorhabditis briggsae: CBG10003Help
Entry
CBG10003          CDS       T01054                                 

Gene name
Cbr-ech-6
Definition
(RefSeq) C. briggsae CBR-ECH-6 protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00062  Fatty acid elongation
cbr00071  Fatty acid degradation
cbr00280  Valine, leucine and isoleucine degradation
cbr00310  Lysine degradation
cbr00380  Tryptophan metabolism
cbr00410  beta-Alanine metabolism
cbr00640  Propanoate metabolism
cbr00650  Butanoate metabolism
cbr01100  Metabolic pathways
cbr01200  Carbon metabolism
cbr01212  Fatty acid metabolism
Module
cbr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cbr_M00085  Fatty acid biosynthesis, elongation, mitochondria
cbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CBG10003 (Cbr-ech-6)
   00650 Butanoate metabolism
    CBG10003 (Cbr-ech-6)
  Lipid metabolism
   00062 Fatty acid elongation
    CBG10003 (Cbr-ech-6)
   00071 Fatty acid degradation
    CBG10003 (Cbr-ech-6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBG10003 (Cbr-ech-6)
   00310 Lysine degradation
    CBG10003 (Cbr-ech-6)
   00380 Tryptophan metabolism
    CBG10003 (Cbr-ech-6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBG10003 (Cbr-ech-6)
Enzymes [BR:cbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CBG10003 (Cbr-ech-6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 8583667
NCBI-ProteinID: XP_002641673
WormBase: CBG10003
UniProt: A8XA54
Position
III
AA seq 288 aa AA seqDB search
MMRFSSMLVRNVRLCANANQMQVAAFSSKAPEMIKVEKVGEKQNVALVKLNRPKALNALC
AQLMTELSDALQNLDTDKSVGAIVITGSERAFAAGADIKEMTNNEFASTFSGSFLSNWTA
VTDVKKPVIAAVNGYALGGGNELAMMCDIIYAGEKARFGQPEINIGTIPGAGGTQRWARA
AGKSFTMEVCLTGNQVSAQEAKDRGIVSKVFPVDQVVGEAVKLGEKIADQSPLIVQMAKE
AVNKAYELTLQEGLHFERRLFHTTFATKDRKEGMTAFAEKRKPQWESK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttctcgagtatgcttgttcgcaatgtcagattgtgcgcaaatgctaaccaa
atgcaagttgctgctttttcaagcaaagctccagaaatgatcaaagtggagaaagtcgga
gagaaacaaaatgttgctctcgtcaaattgaacagaccaaaggctctgaatgccttgtgt
gctcaattgatgactgaattgtcagatgctctccaaaatcttgataccgataagtctgtt
ggagccatcgttattaccggaagcgagagagctttcgctgccggagctgatatcaaggaa
atgactaacaatgagtttgcatctaccttttctggaagttttctctctaactggactgcc
gtcaccgacgtcaagaagccagtgattgcagctgtcaatggatatgcattgggaggtggc
aacgaattagctatgatgtgtgatatcatttatgccggagagaaagctcgttttggtcag
ccagaaatcaacattggaaccatcccaggagccggaggaacccaacgctgggctcgcgct
gctggaaagtcatttactatggaagtttgtctcacaggaaaccaagtctctgctcaagaa
gctaaggaccgtggaatcgtcagcaaggtgttcccagtggatcaagtcgtcggagaagct
gtgaagcttggagagaagattgctgaccaatcaccactgattgttcaaatggccaaagaa
gctgttaacaaggcatatgaactgactcttcaagaaggcctccactttgagagacgtctt
ttccatactacttttgctaccaaggacagaaaggaaggaatgaccgctttcgccgagaag
agaaagccacagtgggaatcgaagtag

DBGET integrated database retrieval system