KEGG   Caenorhabditis briggsae: CBG10210Help
Entry
CBG10210          CDS       T01054                                 

Definition
Hypothetical protein CBG10210
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cbr  Caenorhabditis briggsae
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cbr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 422 aa AA seqDB search
MDFQTPWNLVDENLDIEDLEEFDVPTHGNQRQKQKRNGRKTARKVQKRSRKSGQQEVASK
KTKKAEPVRQPEEKYEEEQDQEEHKPEAQNPVKQLQEEQDQEEQDQADVPGQVALPDGVF
LYKVQSLYRHGVDLHVRSDEPNVMEKPRSLLTAARWRKVHLQSDSFKEGHLITELARKLS
VVDERVLKRHYKSFSEETYGATKTEQMKHMLDQLKVKNDDVIFDLGSGIGQLVTFTASYA
NVAMVYGIEKCDAPADIAARISENFKRLMKFFGKIPSPFELIKGDFTKPANKESIVKKAT
IIFVNNWLFGNELMRDLREILHLCAPGTRVVVTKLIDQTRFNKKTYVGHFNSFSHTAPLD
SIDCPVEWTDKKFDFWVSRMDNEKVYNLAEHFRAEEEEQEAKRETKRLAKAQKAELNSHK
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggattttcaaactccctggaatcttgtcgacgaaaacttggacatcgaagacctcgaa
gaattcgatgtaccaactcacggcaatcagcgacagaaacaaaagagaaatggaagaaaa
actgcgaggaaggtccagaaacgctccagaaaatccggtcagcaagaagttgcttccaag
aagacgaagaaggcagaacctgtaaggcaaccggaggagaaatatgaagaagaacaagat
caagaagaacataaaccggaagcgcaaaatccagtaaagcaacttcaagaagagcaagat
caagaagagcaggatcaagccgatgtccctggacaagtagctcttccagacggagttttt
ctctacaaggttcagagtctctatcgacacggcgtggatcttcacgttcggtctgacgaa
ccgaacgtgatggaaaaaccacgttctctcttaactgccgcaagatggaggaaagtccat
cttcaaagtgattcgttcaaagaaggccatctcatcactgaattggcaaggaagttatct
gttgttgatgaaagagtgctgaagagacactataaaagcttctcggaagaaacttatgga
gcaacgaagacagagcaaatgaagcatatgttggatcaattgaaggtcaaaaatgacgat
gtcatttttgaccttggctctggcattggccaactcgtgacgtttaccgcgagctacgcc
aatgttgccatggtgtacggaatcgagaagtgcgatgcccctgccgacatcgccgctcgg
atttcggagaatttcaagaggctaatgaaattctttggaaagattccgagcccctttgag
ttgatcaaaggggacttcaccaaaccggccaacaaagaatcgatcgtaaagaaggccaca
attattttcgtgaataattggcttttcggtaatgaattaatgcgagacctgcgagaaatc
ctccacctctgtgcccccggaactcgcgtcgtggtcacaaagcttatcgatcaaaccaga
ttcaacaagaaaacttatgttggacatttcaacagcttctcccacacagctccgctggac
agcattgactgtcccgtggaatggacagataagaagtttgacttctgggtatcgaggatg
gataacgagaaggtctacaatctagctgaacattttagagcagaggaggaggaacaggaa
gcgaagagagagacaaaaagattggcgaaagcacagaaggccgagctgaactcccataag
ttttcttag

DBGET integrated database retrieval system