KEGG   Caenorhabditis briggsae: CBG10211Help
Entry
CBG10211          CDS       T01054                                 

Definition
Hypothetical protein CBG10211
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cbr  Caenorhabditis briggsae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CBG10211
Enzymes [BR:cbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CBG10211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 542 aa AA seqDB search
MSNDQHQGFTTLPMPLEPLKEYNYDPLPKDHQKMILLKNVDYYQPGVYAAQPLDSLDSYI
NPETSVYTPIQVKPQIVSETAEDEKLQSKAMEPQFDFNSAEDEELPQKPMKPQIDFDAVK
DEDQNPTEKPEPAQPALISGGKSSRSTKKRNASSKDIKPAKLAKITNIVIDEEENIEALA
APSKSCLADVNDTDDFPLWSIEPVCENGIRLDFFASEPNAASVIRTLFEKIYEPVLATLR
MKKLDWDNVGEHEIGPFLTIFNNKVKFFRRRNPKKALLSKEDWRVEKATQFRIICELACR
LAIPDQTVLNKHYGSFSNGTYGETDYEQFQSILDQLKIKEDDIFIDVGSGIGQLVTFAAA
YSKCANVSGIEIEQVPADFASENGIQFERLMNHFGEQPRPFKLEKGDFKENKHAEFLKNE
AKVIFCNNFAFDPDLMLELRKILESCGSGTKIVVTKKLETTRSENGLAHDCFFTQMAETT
ALQSTGTEKKPNVSWTIKTIDYFLTIMDLEKPIREAEMRAKEQKEHRWARQTRSKRSRAA
KN
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaccaacaccaaggattcaccacactgcccatgcctttagaaccactcaag
gaatacaactacgatcctcttcctaaggatcaccaaaagatgatccttttgaaaaatgtt
gattattatcaacccggtgtatatgcggctcagccattggattctttggactcctatatc
aatcccgagacgagcgtctataccccgattcaagtgaaaccacaaattgtttctgaaact
gctgaggatgaaaagctccaatcaaaagcgatggagccgcaatttgattttaattctgct
gaggatgaggagcttccacaaaagcccatgaagccgcaaatcgattttgacgcagttaag
gatgaagatcaaaacccaacagaaaaacctgaaccagcgcaaccagcacttatcagtgga
ggaaaaagttcgagatcaaccaaaaaacgaaacgcttcatccaaagacattaaacctgca
aaattggcaaaaatcaccaatatcgttatcgatgaggaggagaatattgaagctctcgct
gcaccgtccaaaagctgccttgctgatgttaacgatactgacgattttccgttgtggtcc
atcgagccggtctgcgaaaacggaattcgcttagatttttttgcgagtgagccgaatgcg
gcatcggttatcaggacattgtttgaaaagatttatgagccggtgctggcgacgctccgc
atgaaaaaactcgattgggataacgtcggagaacatgaaattggtccattcttgacaatt
tttaacaacaaagtaaagttcttccgaagaaggaacccaaagaaggcactcctttcaaaa
gaagactggcgcgttgaaaaagcgacacaatttcggatcatctgtgagctggcgtgtcgc
ttggccattccagaccaaacagtgctcaacaagcattatggaagcttcagtaatgggacc
tacggagaaacagattatgaacaattccaatcaattcttgatcagctcaaaattaaagaa
gacgatattttcatcgatgtgggttcgggaataggacaattggtcacttttgctgcggca
tattcaaagtgtgcgaatgtcagcgggatcgaaatcgaacaagttccagctgactttgcc
agcgaaaatggcattcagttcgagaggctgatgaaccatttcggtgagcagccgaggccg
ttcaaattggaaaaaggcgatttcaaggagaataaacatgcagaattcctgaagaacgaa
gcaaaagtaattttttgcaataattttgccttcgatccagacctaatgctggagttgaga
aagatcttggagtcctgtgggtctggcactaagattgtggtcaccaaaaaactcgagacc
acacggtcggaaaacggcctagctcatgattgcttttttactcaaatggcagaaacgact
gctttgcagtcaactggtaccgagaaaaaacccaatgtttcttggaccatcaagacaatc
gactattttttgacgattatggatcttgaaaaaccaatacgagaagccgaaatgagagca
aaagaacaaaaagagcatcgttgggcaagacaaactcgatcgaagaggagcagagcagca
aaaaattga

DBGET integrated database retrieval system