KEGG   Caenorhabditis briggsae: CBG10541Help
Entry
CBG10541          CDS       T01054                                 

Definition
Hypothetical protein CBG10541
Orthology
K04437  
filamin
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 1363 aa AA seqDB search
VSEGILIGSRLRPTINIGKLEPKSKGLQLLDQVNGKLYNIPLKINPDGTYSSDTPLMEVG
EHKMMLLFDEIPVQEATVEVKKGTDVSKCRAYGPGLESAVVGEKAQFELDLDGAGEGALA
MEMRGPAKAESRIQDKGNGKCSVEYITKAPGEYEMAIKFGKDEQKEHVKGSPFKAHVDYK
KDPSQVIINGLDEVSYRLKQPINFIIDTSKTKDLPVTAHVAPEYAQNPPIVTKSPSNPRH
YNVRFVPTGIANTSIPIQILYDGEKVGEKKVKVLPEVEPQLIKILYEKKKESLPITTFAS
HEGHVPFDVRECGNVKKIEACVFGPDGKERVSHVRSTEQAGIYDVSFPTDMAGEYCVVFY
LNGEEVAMKVPVVAEKIGKKEDVLKDDVIFHPEVAENAPTTLTYQHPSETNKKKAKATPS
IRVLAARPDAVRLEHIHEIIDNGHRVAERIMFTPTKLGKNTLNVFYGGEQVDHVEYEAIG
QLEFERIQAERAKVVAEPEDDVDKYEKKYQFNIRDLGCQAKDLEAVVMPPAQKKEVAEII
DNHDGTILVKYIPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVG
EPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGK
AVRDSPFKVLVMGEGQKRSHLSVGSTSEVALPITQSELKGISASIKSPAGIEEPCFVRLL
DGGRLGVSFTPRESGEHLITVKRDGKLVPKAPFKIKVDKSQVGDASKVEVTGAGKAKGIT
LQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKAGLIKVLYTPTEPGVYAIAIKFAD
HHVKDSPLTVQCTGKSAGRVIQTIQKGVDQHGICLPDQESLLFLKLLNTSPMDITARLMD
PKGHTDDIEMRDLGQQYYQLKFTPKLEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHK
IRAAGQGVVRGETGTLNAFNIYHREAGAGALAVSVEGPSKATLEFKDHKDGNCHVDYKVA
TPGEYIVAVKFNDQHIPDSPFKVFVAPATGEVRKLELAQFHDQGIPSGKAFTFTVLTHRA
KGHLEAKVVAPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRDSPFRLR
VGGKDLCDPTAIFASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELE
KGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTS
KGTVAVVPEYAGDAAKVTAKGAGLNKFFPGRPAAFQIDTGMAGQNLLMVGVVTTKGPCEE
VVVRHQGQGHYVCSYRIPERVKGFVFIKYGDKEIPGSPFAIEP
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
gtttcagaaggaattctcattggctcacgtcttcgtcctaccatcaacattggaaaactg
gaaccaaaatcgaagggcctccaactcctcgaccaagtgaatggaaagctctataacatt
cctctgaagatcaatccagatggcacctactcatcagacacccctctcatggaagtcggt
gagcacaaaatgatgcttctgttcgacgagattccagtccaagaggctactgtagaagtg
aagaagggaactgacgtgagcaaatgccgtgcttatggaccgggtcttgaaagtgcagtt
gtcggagagaaggctcaattcgaactggacttggatggtgctggagagggagcactggcg
atggagatgcgtggtccagcgaaagccgagtctcgaattcaagacaaggggaacggaaag
tgcagtgttgagtacattacgaaggctccaggggagtacgaaatggcgattaagttcgga
aaggatgagcagaaggagcatgtcaaaggatccccattcaaggcgcatgtcgactataag
aaggatccatctcaagtgattatcaatggattggatgaagtcagttatcgactcaaacaa
cctatcaatttcatcattgatacttccaagaccaaggacttgccggtcactgctcatgtc
gctccagaatacgctcagaatccaccaatcgtcacgaagtctccatccaatccacgtcac
tataatgtgcgtttcgtgccgactggaattgcgaatacatcgattccaattcagattctg
tatgatggagagaaagtcggagagaagaaggtcaaggtgctgccggaggtggagccgcaa
ctcatcaaaattctttacgagaaaaagaaggagtcgttgccaatcaccacctttgcctcg
cacgaaggacatgttccattcgatgttcgcgagtgtggaaacgtcaagaagatcgaggcc
tgtgtcttcggaccggacggaaaagaacgtgtaagccatgtacgatccaccgaacaagcc
ggcatctacgatgtctcattcccaaccgacatggctggcgagtactgtgtcgtgttctat
ttgaacggagaagaagtggcgatgaaggtgccggtggtagctgaaaagattggaaagaaa
gaggacgtgctcaaggatgacgtcatcttccatccagaagtcgctgaaaacgcgccaacc
acgttgacctatcaacatccatcggagacgaataagaagaaggcgaaggcgacgccatct
atcagagtgttggctgctcgtccagatgccgttcgtttggagcacatccatgagatcatt
gataacggacatcgggtcgccgagagaattatgttcactccaacgaagctgggaaagaat
acgttgaatgttttctatggaggagaacaagtggatcatgtggagtatgaggctatcgga
cagctcgaattcgagcgaatccaagcggaacgcgccaaagtcgttgcggagccagaggac
gacgtcgacaagtacgagaagaagtatcagttcaacatccgcgatttggggtgccaagca
aaggatcttgaagccgtcgtcatgccaccagcacagaagaaagaagtcgccgagatcatt
gacaaccacgatggaaccatcctcgtgaagtacataccaaaggtccacggatcccatgag
ctctcgatccttcaaaacggagcacaactccaaggaacaccaatcaagttctacgtggat
gcctatggagatggatgggccacggtctatggaccaggtcttcagaatgccgttgttgga
gagccagccacgttcacagtgtgcgccaagggatctcaagccaaggagctgtcggtgagc
attgaaggaccagcaaagagtcagataaagatccatgacaacaaggatggcacatgctcg
gcagcgtgggttccaccagtgccaggagagtacaaggttcatgtgaagttgggaggaaaa
gctgtcagagactcaccattcaaagtgttggttatgggagagggacagaagcgctctcat
ctgtcagttggatccacatccgaagttgctcttccaatcacccaatccgaattgaaggga
atttcagcttcaatcaagtcaccagctggaattgaggagccatgcttcgtccgtcttctt
gatggaggacgtcttggagtctccttcactccacgtgaatctggagagcacttgattacg
gtgaaacgtgatggaaagttggttccaaaggctccattcaagatcaaggtggacaaatca
caagttggagatgcttcgaaggtcgaagtcactggagcaggaaaggctaagggtattacc
ctccaggcaaatgagctgttggttgacacatccaaggctggatatggaggactttctgtg
tcggtacaaggaccatcgaaggcggagttgacttgcaaggaggtcaaggctggactcatc
aaggttctctacactccaaccgagccaggagtctacgctatcgccatcaaattcgctgat
catcacgtcaaggactcgccactcactgttcaatgcactggaaaatcggctggacgtgtt
atccagacgatccagaagggtgtcgatcaacacggaatctgtctcccggaccaggaatcg
ttgttgttcttgaagctgttgaacacgtcgccaatggacatcacggcccgtttgatggat
ccaaagggacacaccgatgatatcgagatgcgtgatttgggacagcaatactatcaattg
aagttcacaccaaagttggaaggaatccatacactttctgttatgtacaaagatgctcac
gtcaatggatcgccattccagttcactgttggatcattctccgaaggaggagctcataag
atccgcgccgccggtcaaggagtcgtccgtggagaaactggaactctcaacgccttcaac
atctaccatcgtgaggctggagccggagcccttgctgtctccgttgagggaccatccaaa
gctaccctggaattcaaggatcacaaggatggaaactgccacgttgactacaaagttgcc
actcctggggagtacatcgtcgctgtgaaattcaacgaccagcacatcccagactcgcca
ttcaaggtgttcgtcgcgccagcaactggagaggtccgaaaactcgagttggctcaattc
cacgatcaaggaattccatctggaaaagcgttcacattcacagtgctcactcatcgtgcc
aagggacatctcgaggctaaagtggttgcaccgaacaacgaagtggacaccattgatatt
gttccaattgaggatggtgagagctatgcgatgcgattcgtgccaaaggagactggaaat
catttcatccatgtgactcttgacggtgctccaatgcgtgattctccatttagacttcgt
gtcggaggaaaggatctttgtgatccaactgctatctttgcttctggagatggtctcgtc
aaaggaaccaccggacagaagtgcgaattcgttatcaacacggccaacgctggagctgga
atccttaccgtccaaatggacggtccatcgaaagccacgctggatgcgtatgagctggag
aagggatacaaagtgagatacactccattggctccaggatcctactttgcatccgtcaag
tacaatggaattcatgcgccaggatcgccattcaagattccggtcgaaggaaaggagctc
ggaggaaatggatacaacgagacgtcgcatgtgaagatcgacgctgtcgccaagacttcg
aagggaaccgtcgctgttgttccagaatacgcaggagatgctgctaaggtcaccgccaaa
ggagccggcctcaacaagttcttccctggccgaccggctgcattccaaatcgacaccgga
atggcgggtcagaatcttcttatggttggagtcgtgacgaccaaaggaccatgcgaggag
gttgtcgttcgtcatcaaggccaaggacactacgtctgctcctaccgtatcccggaacga
gtcaaaggattcgtgttcatcaagtacggcgacaaggaaatccccggatctccattcgcc
attgagccataa

DBGET integrated database retrieval system