KEGG   Caenorhabditis briggsae: CBG10789Help
Entry
CBG10789          CDS       T01054                                 

Gene name
Cbr-pdi-3
Definition
C. briggsae CBR-PDI-3 protein
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CBG10789 (Cbr-pdi-3)
Enzymes [BR:cbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CBG10789 (Cbr-pdi-3)
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CBG10789 (Cbr-pdi-3)
  Exosomal proteins of colorectal cancer cells
   CBG10789 (Cbr-pdi-3)
  Exosomal proteins of bladder cancer cells
   CBG10789 (Cbr-pdi-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 488 aa AA seqDB search
MIWVQAALVASLLAFASAGGAVLEYTDGNFEDLIQTHDIALVKFYAPWCGHCKKMAPEYE
KAAPKLASNDPPVALIKVDCTTEKTVCDKFGVKGFPTLKIFRNGSPAQDYDGPRDADGIV
KFMRGQSGPSSKELKTVDEFEKFTGGDENVVVGFFESESKLKDSFLKVADTERDRFAFAH
TSNKDIIKKAGYSDDVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHETVGLAGIRT
QGNLFQFEQKPIVIVYYNVDYVKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEI
ETNGLGERKDSDKPIVAVLTNEGKFPMDQEFSMDNLQQFVDEVLAGNAEPYMKSEPIPDE
QGDVKVAVGKNFKQLIMDADKDVLIEFYAPWCGHCKSLAPKYEELAQKLNKEDVIIAKMD
ATANDVPPLFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVNFISKHSTDGLKGFSRDG
KKKKHTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatttgggtacaggcagctttggtcgcctccctcctggctttcgccagcgctggagga
gccgttctcgaatacactgatggaaacttcgaagatctcatccagacacatgatatcgcc
cttgtaaagttctacgctccatggtgcggacattgtaagaagatggctccagaatacgag
aaggctgctccaaagcttgcttccaacgacccaccagttgccctcattaaggtcgattgt
accaccgagaagaccgtttgcgataaattcggagtcaagggattcccaaccttgaagatc
ttccgcaacggatccccagctcaagactatgatggaccacgtgatgctgacggtatcgtt
aagttcatgcgtggacaatctggaccatcatccaaggaattgaagactgttgacgagttc
gagaagttcactggaggagacgagaatgttgttgttggattcttcgaaagcgagagcaag
ctgaaggactcattcctcaaggttgctgatactgagcgtgatcgtttcgctttcgctcac
acttccaacaaggacatcatcaagaaggccggatactccgatgacgttgttgtctttgtt
ccaaagaagcttcacaacaagttcgataccaatgagttcaagtacgacggaaactacgac
actgataagattaagaacttcttggtccacgaaactgttggacttgctggaattcgtacc
caaggaaacttgttccaattcgagcagaagccaatcgtcattgtttactacaatgttgac
tacgtcaaggatccaaagggatcaaactactggcgtaatcgtgttctcaaggttgctcaa
aactacaagagaaaggttcaattcgctgtttccaacaaggaagaattttcttctgaaatc
gagactaacggacttggagagcgcaaggattccgacaaaccaattgttgccgtcctcact
aacgaaggaaagttcccaatggatcaagaattcagcatggacaacctccaacaatttgtt
gacgaagttctcgctggaaatgctgagccatacatgaagtctgagcctatcccagatgag
caaggagatgtcaaggttgctgttggaaagaacttcaagcaacttatcatggatgctgac
aaagatgttctcattgagttctatgctccgtggtgcggacactgcaaatctttggctcca
aagtacgaggagctcgcccaaaagctcaacaaggaagatgtgatcattgctaagatggac
gccaccgccaacgatgtgccaccacttttcgaagttagaggattcccaaccctcttctgg
cttccaaagaacgcaaaatcgaacccaatcccatacaatggaggacgtgaagtgaaagac
tttgtcaacttcatctcgaagcactcaactgatggactcaaaggattcagccgtgacgga
aagaagaagaagcacaccgagctgtaa

DBGET integrated database retrieval system