KEGG   Caenorhabditis briggsae: CBG10818Help
Entry
CBG10818          CDS       T01054                                 

Definition
Hypothetical protein CBG10818
Orthology
K11252  
histone H2B
Organism
cbr  Caenorhabditis briggsae
Brite
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBG10818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 123 aa AA seqDB search
MAPPKPSAKGAKKAAKTVTKPKDGKKRKAHRKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaaagccgtcagccaagggagcgaagaaagccgccaagaccgtcaccaag
ccaaaggacggaaagaagagaaaagcccatcgcaaggagtcgtactctgtctacatctac
cgtgtcctcaagcaggttcacccagataccggagtatcctcgaaggccatgtccatcatg
aactccttcgtcaatgacgtcttcgaacgcatcgctgctgaagcttctcgtcttgcccac
tacaacaagcgttcgaccatctcttcccgcgaaatccaaacggccgtccgtttgatcctt
ccaggagagttggccaagcacgccgtttctgagggaaccaaggctgtgaccaagtacaca
tccagcaagtaa

DBGET integrated database retrieval system