KEGG   Caenorhabditis briggsae: CBG10827Help
Entry
CBG10827          CDS       T01054                                 

Gene name
Cbr-mat-1
Definition
C. briggsae CBR-MAT-1 protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cbr  Caenorhabditis briggsae
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:cbr04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 790 aa AA seqDB search
SAGSGPVTPQLREMIVRCSSDKKRTIAQEITEMMTYYAFDDAIFLAELYYETQTDPDNLE
EALFLYADCLYRANKKEECYGLLRSADLSGAKLHYLFARVAFDLSKNDECRGALFEHDNG
IIREAILEDSRVAAHANFLHAQLLCDENHMDLAVESCEKALDENIFLWTAIITYLRFGGE
NLSATFDKHSDKTNGSEVTSPSAVMKSATPSSTSAGPSVSSIATREAGNSSRGPSTRRTT
RSSVPSVDRELRYLPATTSSRQTTTPVTTSGRTRPVAPRKSSRISEMSSRRSDSSATTAS
TAAACRAALFTQPERPHTRATHSSRNRSNAALNSDTENSNAVNTRSRDTGGSRGSASSQR
TNPVRSSIRIADAAANKNSKNANQRKRNEKQPLVSRNSNLARSLSGSSNSVASTGSDRLS
DDGLSQMNAPMSSVASSLNNDDLGDAVEVSYDDRYKWLFDLYRHISFIEECISTYNWKTA
DALFAKLDKEILLNTSMIRLQLGRACFEQSEYRECRVILSDLHERKKWKVEGTELLSTSM
WHLQDTHALSALAQTLTTESRERAQSWCVAGNCFSLQRQHTQAIECMERAIQLDKRFAYA
YTLLGHELIVQDDLDKASGSFRSALLLSPRDYRAWYGLGLVHLKKEQNTIALTNIQKAVS
INPTNRAMLCTLSTIEQRGKTDTALVLIDRALTLNPLDVACRFNRARLLFESKRNDECLK
ELEKLKASSPDEAFIYHLLARVHRRMGNTHLALLSYSWAAELDPRGEQNPTDTNHVTREE
YEDDEYGSPV
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
tcagccggctccggaccggtcacgccccaactgagggaaatgattgttagatgttcttcg
gacaagaagagaacaattgctcaggaaattaccgaaatgatgacatattatgccttcgac
gatgccattttcttagcagaactctactatgaaacccaaactgatccagataatctcgaa
gaagcacttttcttgtatgccgactgtctgtatagagccaacaaaaaagaagaatgttac
ggtcttctacggtcagcagatttgagtggagcgaagcttcattatctttttgcaagggtt
gcatttgatttgagcaaaaacgatgaatgtagaggagctttatttgaacatgacaacgga
atcatacgggaggcgattcttgaagattcacgggtagcggctcatgcgaatttccttcat
gctcaattgctctgcgatgaaaatcacatggacctcgccgtcgagtcatgtgaaaaagct
ttagacgaaaacattttcttgtggacagctattataacatatttacggtttggaggagaa
aatctttctgctacatttgataaacatagcgataaaacaaacggttctgaagttacaagt
ccgtcagctgttatgaagtctgcaacaccgtcttccacatctgctggcccatctgtatca
tctattgcaactcgagaagctgggaactctagtcgtggaccttccacaagaagaaccacg
cgctcatctgttccttctgtagatcgtgagcttagatacctcccagccacaacgtcttct
cgacagacaaccactccagtgaccactagtggtcgtacccgtccagttgcaccacgaaaa
agttcgcgaatcagtgagatgtcgagtcggcgctcagattcaagcgctaccactgcctct
acggctgctgcatgcagagcggctctattcacacaaccagaaagaccgcacactcgagca
acgcatagttccagaaaccgttcaaatgcggcgttgaacagtgacactgagaactcgaac
gcagtcaacacgagatccagggacacaggtggcagccggggatccgcatcgtctcagagg
accaacccagtgcgctcctcaatcagaattgctgatgctgcagcaaataagaattccaaa
aatgcaaatcaaaggaagcgaaatgaaaagcagccattggtttctagaaactcgaattta
gcgcgcagcttgtcgggttcctccaattctgtggcatccacaggaagcgatcggttgtca
gacgacggcctgtctcagatgaatgctccaatgtcttcagtggcttcctcgttgaataac
gatgacctaggagatgcagtagaagtttcatacgacgatagatacaagtggctattcgat
ttataccgccacatttcgttcattgaggaatgtatcagcacttataactggaaaacagct
gatgctctgttcgcgaaacttgataaagaaattctactcaacacatcaatgatccgttta
cagctaggaagagcttgtttcgagcaatctgagtacagagagtgtcgtgtcatcctcagt
gacttgcacgagcgaaaaaagtggaaggttgaaggaacagaactgttgtcgacatcaatg
tggcacctacaagacactcatgctctttctgcactcgcacagaccctgacgacagaatct
cgggaaagagcacaaagttggtgtgttgctgggaattgtttctcattgcaaagacagcat
acacaagcgattgaatgtatggagagagctatccaacttgataaacgatttgcatatgcc
tacacacttctagggcatgaattgatcgtgcaagatgatcttgataaggcatcaggatca
ttcagatctgccctactgctctcccctcgcgactaccgtgcttggtatggtcttggtcta
gtccatctgaagaaggaacaaaatacgattgcactaaccaatatccaaaaggcagtcagt
attaatcccacgaatcgagcaatgctctgcacactttccacaatcgagcaacgaggaaaa
acagacactgctcttgtcctgatcgatcgcgcattgactctcaatccactggacgttgca
tgccgattcaatcgcgctcgtcttcttttcgaatcaaagcgaaatgatgagtgtctgaag
gagctggaaaaattgaaagcaagctcgcccgacgaggccttcatctatcatttacttgca
cgcgttcatcgaagaatgggaaacacacacttggctctattgagctacagttgggcggct
gagcttgatcctcgcggagaacagaatccgacagacaccaaccatgtgacaagggaagag
tacgaggacgacgaatacggttccccagtttaa

DBGET integrated database retrieval system