KEGG   Caenorhabditis briggsae: CBG10827Help
Entry
CBG10827          CDS       T01054                                 

Gene name
Cbr-mat-1
Definition
C. briggsae CBR-MAT-1 protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cbr  Caenorhabditis briggsae
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CBG10827 (Cbr-mat-1)
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CBG10827 (Cbr-mat-1)
Ubiquitin system [BR:cbr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CBG10827 (Cbr-mat-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 790 aa AA seqDB search
SAGSGPVTPQLREMIVRCSSDKKRTIAQEITEMMTYYAFDDAIFLAELYYETQTDPDNLE
EALFLYADCLYRANKKEECYGLLRSADLSGAKLHYLFARVAFDLSKNDECRGALFEHDNG
IIREAILEDSRVAAHANFLHAQLLCDENHMDLAVESCEKALDENIFLWTAIITYLRFGGE
NLSATFDKHSDKTNGSEVTSPSAVMKSATPSSTSAGPSVSSIATREAGNSSRGPSTRRTT
RSSVPSVDRELRYLPATTSSRQTTTPVTTSGRTRPVAPRKSSRISEMSSRRSDSSATTAS
TAAACRAALFTQPERPHTRATHSSRNRSNAALNSDTENSNAVNTRSRDTGGSRGSASSQR
TNPVRSSIRIADAAANKNSKNANQRKRNEKQPLVSRNSNLARSLSGSSNSVASTGSDRLS
DDGLSQMNAPMSSVASSLNNDDLGDAVEVSYDDRYKWLFDLYRHISFIEECISTYNWKTA
DALFAKLDKEILLNTSMIRLQLGRACFEQSEYRECRVILSDLHERKKWKVEGTELLSTSM
WHLQDTHALSALAQTLTTESRERAQSWCVAGNCFSLQRQHTQAIECMERAIQLDKRFAYA
YTLLGHELIVQDDLDKASGSFRSALLLSPRDYRAWYGLGLVHLKKEQNTIALTNIQKAVS
INPTNRAMLCTLSTIEQRGKTDTALVLIDRALTLNPLDVACRFNRARLLFESKRNDECLK
ELEKLKASSPDEAFIYHLLARVHRRMGNTHLALLSYSWAAELDPRGEQNPTDTNHVTREE
YEDDEYGSPV
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
tcagccggctccggaccggtcacgccccaactgagggaaatgattgttagatgttcttcg
gacaagaagagaacaattgctcaggaaattaccgaaatgatgacatattatgccttcgac
gatgccattttcttagcagaactctactatgaaacccaaactgatccagataatctcgaa
gaagcacttttcttgtatgccgactgtctgtatagagccaacaaaaaagaagaatgttac
ggtcttctacggtcagcagatttgagtggagcgaagcttcattatctttttgcaagggtt
gcatttgatttgagcaaaaacgatgaatgtagaggagctttatttgaacatgacaacgga
atcatacgggaggcgattcttgaagattcacgggtagcggctcatgcgaatttccttcat
gctcaattgctctgcgatgaaaatcacatggacctcgccgtcgagtcatgtgaaaaagct
ttagacgaaaacattttcttgtggacagctattataacatatttacggtttggaggagaa
aatctttctgctacatttgataaacatagcgataaaacaaacggttctgaagttacaagt
ccgtcagctgttatgaagtctgcaacaccgtcttccacatctgctggcccatctgtatca
tctattgcaactcgagaagctgggaactctagtcgtggaccttccacaagaagaaccacg
cgctcatctgttccttctgtagatcgtgagcttagatacctcccagccacaacgtcttct
cgacagacaaccactccagtgaccactagtggtcgtacccgtccagttgcaccacgaaaa
agttcgcgaatcagtgagatgtcgagtcggcgctcagattcaagcgctaccactgcctct
acggctgctgcatgcagagcggctctattcacacaaccagaaagaccgcacactcgagca
acgcatagttccagaaaccgttcaaatgcggcgttgaacagtgacactgagaactcgaac
gcagtcaacacgagatccagggacacaggtggcagccggggatccgcatcgtctcagagg
accaacccagtgcgctcctcaatcagaattgctgatgctgcagcaaataagaattccaaa
aatgcaaatcaaaggaagcgaaatgaaaagcagccattggtttctagaaactcgaattta
gcgcgcagcttgtcgggttcctccaattctgtggcatccacaggaagcgatcggttgtca
gacgacggcctgtctcagatgaatgctccaatgtcttcagtggcttcctcgttgaataac
gatgacctaggagatgcagtagaagtttcatacgacgatagatacaagtggctattcgat
ttataccgccacatttcgttcattgaggaatgtatcagcacttataactggaaaacagct
gatgctctgttcgcgaaacttgataaagaaattctactcaacacatcaatgatccgttta
cagctaggaagagcttgtttcgagcaatctgagtacagagagtgtcgtgtcatcctcagt
gacttgcacgagcgaaaaaagtggaaggttgaaggaacagaactgttgtcgacatcaatg
tggcacctacaagacactcatgctctttctgcactcgcacagaccctgacgacagaatct
cgggaaagagcacaaagttggtgtgttgctgggaattgtttctcattgcaaagacagcat
acacaagcgattgaatgtatggagagagctatccaacttgataaacgatttgcatatgcc
tacacacttctagggcatgaattgatcgtgcaagatgatcttgataaggcatcaggatca
ttcagatctgccctactgctctcccctcgcgactaccgtgcttggtatggtcttggtcta
gtccatctgaagaaggaacaaaatacgattgcactaaccaatatccaaaaggcagtcagt
attaatcccacgaatcgagcaatgctctgcacactttccacaatcgagcaacgaggaaaa
acagacactgctcttgtcctgatcgatcgcgcattgactctcaatccactggacgttgca
tgccgattcaatcgcgctcgtcttcttttcgaatcaaagcgaaatgatgagtgtctgaag
gagctggaaaaattgaaagcaagctcgcccgacgaggccttcatctatcatttacttgca
cgcgttcatcgaagaatgggaaacacacacttggctctattgagctacagttgggcggct
gagcttgatcctcgcggagaacagaatccgacagacaccaaccatgtgacaagggaagag
tacgaggacgacgaatacggttccccagtttaa

DBGET integrated database retrieval system