KEGG   Caenorhabditis briggsae: CBG10979Help
Entry
CBG10979          CDS       T01054                                 

Gene name
Cbr-ist-1
Definition
C. briggsae CBR-IST-1 protein
Orthology
K16172  
insulin receptor substrate 1
Organism
cbr  Caenorhabditis briggsae
Pathway
FoxO signaling pathway
mTOR signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CBG10979 (Cbr-ist-1)
   04150 mTOR signaling pathway
    CBG10979 (Cbr-ist-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 1121 aa AA seqDB search
PKDMGEYVETDFRAPETRRPDQVIPRQEESPNRASIAVADSDERTRRESRQQGQFEEEDK
GKQMKNPEKRRDPNQDKALREALPKLTVEDLPQDEDPDEFGIPNLYKCGNCLVGFAPVVS
SKSYLVNIEKHFQKKKKLMFVTLTERCLELYESEKAYRAGKCSKHLVDLAMTFNVHSDHF
DAKLKKCLCLMGPDETICMRPEGGILTIEGWRRAIVKAVHEARRRKMDRIPRPEDIFDAC
YDIRVCMTPKNNDNYLNDIKTQGMTSICTIVKELLGKKRLCLFPNSLAIVDICIEPTAFG
LPPAGFPPFRAANMFILERSCVAYYGFKDGYFFIRIGKGSPYRGYEILFQVENNDVCKEI
YSRIRVLIERDAEIRKQALAVREMKFRNFAQFEFFRRAEASDTPGMESLSVPSTLLHRTK
LSLDSPVITPRDRRLLLGRDCLSFASLEKDDSAPSSPFANYNRPRGSLGNFQLDHLSRQR
IPTMPNAKPQDAGLREVLFEAYAMKKKNSTQSERGEIVIPDPERKMSDNRSRRPTDGKKE
YVILLDSARPRLPPLKLDASKPSGEFLLSIQKEKERMEEARRNGYDGKTHNPDGSLRDPN
KKAFLDTICPPPAPPELVIAEKVAERSEYTVMGPADWGKVEELSRDDYSDSGDSCYSSRV
RIFDFSAINMFILQRGTETQRSRPLQPHLACQMPNRAQSFGAKQLTFSNRLPPTVNLPDS
ERKISAAVQSSTSNQLDLPNDDPRKRAFSLGSRNFFNMIGLNDFRRLVSKRHRTTSPNQT
STSGISLNSSNASPSASSNFLASAEYLEHNRTESIGSSARSSPSKGYSTQRMNSPKEDDL
MSIDFSKLGKKRNSITDTRRFPFGGSGPGGSMDYNREKQEREEEEKRDREQKAMDLKRKE
MQEARELAAKKAEADKKVEQKKQRKLEKEREREREKEKDHDHDKDFRPKADSGIADCTPS
SSFSGKKDGKDGEGKVSSYVDPEGLKFLADIKKRKKELENYGTTTSSTSSLSTIVSVEDN
KYVIKAQNLFFQNAWSRKGSTDITQAIAAIDINRRSSVCAELNRKPSVCTAIMEEREGEA
SESESRGEPSVAPAPVTRKPASTGSPFMSPFRRLKFLSFRK
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
ccaaaagatatgggtgaatacgtggaaacggacttcagagcaccggaaaccagaaggcca
gatcaggtgataccgaggcaggaggagtcaccgaatcgagcgtctatcgcggttgctgat
agcgacgagcgaactcggagagaaagtaggcaacaaggacaattcgaggaagaagataaa
ggaaaacaaatgaagaatccagagaaaagacgcgatccgaatcaagacaaggcgttgaga
gaggctcttccaaaactaacagttgaagatctaccccaagatgaggatccagatgagttt
ggaatcccaaatctttacaagtgcggaaactgtttggttggatttgcgccagtggtgagt
tcaaaaagttatttggtaaatatagaaaaacattttcagaaaaaaaagaaactgatgttt
gtgacacttacggaacgttgtctagagctctacgagtctgaaaaggcttatcgagctgga
aaatgctcgaaacacttggtggatctggcaatgactttcaatgtacacagtgatcacttc
gacgcaaaactcaaaaagtgtttgtgtttaatgggtccagatgagacaatctgtatgaga
ccggaaggaggaattctaaccattgaaggatggcgtcgagcaatagttaaagctgtacat
gaggcgagaagaagaaaaatggatcggattccaagaccggaagatattttcgacgcttgc
tatgacatccgagtttgtatgaccccgaaaaataatgataattatttaaatgatatcaag
acacaaggaatgactagtatatgtactattgtcaaggagcttctaggaaagaaaagacta
tgcttgtttccaaattctcttgccattgttgatatatgcatcgaaccaaccgcattcggg
cttccaccagctggttttccaccattccgagctgcaaacatgtttatattggagagaagt
tgtgttgcctattacggattcaaggatggatattttttcattcgaatcggcaaaggaagc
ccgtaccgtggatacgagatcctttttcaagtggaaaacaatgacgtatgcaaagaaata
tattcacgtattagggtgctgattgaacgggatgcggaaataaggaaacaagctttagca
gtgagggaaatgaaatttaggaattttgctcaatttgaatttttcagaagagctgaagca
agcgatacgcctggaatggaatcgctttctgttccctcaacgcttttgcatcgtactaaa
ctgtcgctagactcacctgtcattaccccaagagatcgccgtttgcttctgggaagagat
tgtctctcgtttgcatctctcgagaaggatgattctgctccatcgtctccattcgccaat
tataaccgcccacgaggctcattgggaaacttccagcttgatcatttgtctagacaacgt
attccaacaatgccaaatgcaaaaccacaggatgcaggtcttcgtgaagttttatttgaa
gcttatgctatgaaaaagaagaattcaactcaatctgaacggggagaaattgtgattccg
gatccggagagaaaaatgtcggataacagatcacgtagaccaactgacgggaagaaagag
tatgttattctcctggattcggcaagaccacgtcttcctcctttaaagctagatgccagc
aaaccgtctggagagtttttattgtctattcaaaaagaaaaagagcgaatggaagaagct
agacgcaatggatatgatggaaaaacccataacccggacggtagtctacgggatccaaac
aaaaaagcttttctcgacacgatatgcccgccacctgctccgccagagcttgttatcgct
gaaaaagtagctgagcgtagtgaatacactgtgatggggcctgccgattggggcaaagta
gaagaattgagcagagatgactactccgacagtggtgacagctgttattcgtcgagggtg
aggattttcgacttttctgctataaacatgtttatccttcagagaggaactgaaactcag
cgttctcgaccgctacaaccgcatttagcatgtcagatgccgaacagagcacagtccttc
ggggccaaacaactgacattctctaataggcttccaccaaccgtgaatctgccagattcg
gagcgcaaaatctcggctgctgtgcagagctccacttccaatcagttggaccttccaaac
gatgatcctcggaaaagagcattttcccttgggagcagaaacttttttaacatgattgga
ttaaacgatttccgccgacttgtcagcaaacgtcatcgcaccacgtcaccaaaccaaaca
tccacttctggaatatcgctgaattcgtccaatgcttcaccatctgctagcagtaacttt
ttggcatctgcagagtacttggaacacaacaggactgaaagtattgggtcttctgctaga
agtagtccctccaaaggatactctactcaacgcatgaattcccccaaagaagacgatctc
atgtctattgatttctccaagttgggtaagaaaagaaactccatcaccgacacacgacgc
tttcctttcgggggcagtggtccgggtggctcaatggactacaatcgagagaagcaggag
cgagaagaagaagaaaaacgggatagagagcagaaggcgatggatctgaaaagaaaggaa
atgcaagaagcacgagagttggccgccaaaaaagcggaagccgacaaaaaagttgagcag
aaaaaacagaggaaattggagaaggagcgagaaagggaaagggagaaagaaaaggaccat
gaccatgacaaagattttcgtccaaaggccgatagtggcattgctgactgcacaccaagc
tccagtttctctggcaagaaagatggcaaagacggtgaaggcaaagtttcatcatatgtt
gatcctgaaggattgaagtttcttgctgacattaaaaagcggaagaaagagctggagaac
tatggaacaaccacctcatcaacttcgtccttgagcacaatcgtttcagttgaagataac
aagtatgtgatcaaagctcaaaacctcttttttcaaaatgcgtggtctcgcaaaggttcc
accgatataactcaagccatcgcagctatagatatcaacagacgatcttctgtatgtgct
gagctcaatcgcaagccgtctgtttgtactgcaatcatggaggagagagaaggagaagct
tcggagagcgagtctcgaggagaaccatctgtggctcctgctccagttacacggaaacct
gcatcaactggaagtccgttcatgagcccattcagaagactcaaattcctctctttccgt
aaa

DBGET integrated database retrieval system