KEGG   Caenorhabditis briggsae: CBG10982Help
Entry
CBG10982          CDS       T01054                                 

Gene name
Cbr-lam-2
Definition
C. briggsae CBR-LAM-2 protein
Orthology
K05635  
laminin, gamma 1
Organism
cbr  Caenorhabditis briggsae
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    CBG10982 (Cbr-lam-2)
Cell adhesion molecules and their ligands [BR:cbr04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      CBG10982 (Cbr-lam-2)
     Laminin-2 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
   VLA-3
      CBG10982 (Cbr-lam-2)
     Laminin-10 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
     Laminin-11 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
     Laminin-8 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      CBG10982 (Cbr-lam-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 1633 aa AA seqDB search
MTSIQWLFYLAVLWQVSHPQPAELYPSIDPNHFGADGNPCYDRSTHQPQRCVPDFVNAAF
NLDVQVTNTCGTKRPTKFCVQSGHTGQRSVCETCDNRHEGFSHPAKFLTDFNVGNNETWW
QSDTMMEGMQFPTSVNLTLTLGKSFDITYVRLKFISPRPESFTIYKKTTADDDWTPWQYY
SGSCRATYGIPDRAPILPGNENVAQCTKEFSDISPITGGNIAFSTLEGRPSAHIFEESDV
LQNWVTASAIKISLNRMNTFGDEVFRDPQVLKSYYYAISDFAVGGRCKCNGHASECVGSS
SVDGENRLVCRCEHNTQGADCNECLPFYNDRPWKAGTANEANECIACNCSQLSNRCYFDQ
QLFEQTGHGGHCIDCQGNTQGVHCEQCVANHWRRPGENYCVACGCNEIGSLSTQCDNEGK
CQCKPGVTGRFCDQCLDGYYDFSTNGCKNCGCEASGSLNNQPRCDSTSGSCTCKLNVEGR
QCDKCKPGYFDLSTENQFGCTPCFCFGHSSICSTADGYFAVNVSSVFEKEKENWKGQNRI
GLQDAIFAELDKAVAVSDTDNSPVYFVAPQQFTGDQRSSYNQDLVFTLRVTNHVTNQDVK
DIIIVGADRQELSTSITAQGNPFPSNEGKTYRFRIHADPYFGWYPRINELDFIGILSNIT
AIKIRGTYSYKDIGYLSNVHLGSAGLAPSESNPKQATWIEHCECLPGFVGQFCESCEPGF
RRETKFGGPFNRCIKCDCHNHSNSCEAESGSCICEHNTAGDTCERCARGYYGDALQGTSE
DCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGFFGNPKDDIECNECACNNN
TDPNSIGNCDKITGECKKCVYNTHGFNCEKCKPGYWGDALIEPKGNCRPCGCFAAGTRRP
NNDYTLLECEQTDGQCECLPNVWGMQCDQCESGFYNITSGLGCQECGCDPLGSEGNTCDV
VTGQCLCKPGVIGQHCDQCAPYHFGFSANGCQPCDCEYIGSESQQCDVNNGQCLCKENVE
GRRCDQCAENRYGITQGCLPCDDCYTLIQSRVNTFREKVKSLDNTLQEIIENPAPVNDTK
FDEKVKETSRAATEVWEAVKQKTKEGGGTIKTKSKAIKEEIMTALEKLTTIDDSVSQARV
GADAAENDMRRWEIIIENARREIENVLHYLETEGDERAQIAYNASQKYGEQSKRMSELAQ
GTREEAEKHLKQAMEIEKLSELAIANATQANKEASDAIYGGEQISKQIAELKEKQNQINE
SISRTLDLAEEQKKTADEANNLAAVSLTNVEAVKIPSVDPKELKNDVAGVLEEAENLVDS
SYKENAANDELFEEVERTVADSRNELQSAQDQQRVSDQLMLELEKAREKIVDSVTNADKT
LKDAEAVLASLEEFTSKIEQSRNDAVAEFANVESINKKLDGVLVAQDAKRNSLPLDRQFT
ADYRKSADVLLDETAVLVDKYKDLINTEVDTQDSTEAINGDIEQLMEELTESKENLEYYR
KQAEDDKLMATEAVRKATLAKNSAIDANSTILSEQDEIKKIIDALNTMEEVNNAELDELE
EELDKLDQMLAQAALAQEVPNFQQYRADEDAKVQQLKNDITELQKEVVNLEEIRDNLPTK
CFNVINLEQEGQK
NT seq 4902 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgatacagtggcttttctaccttgccgttttatggcaggtcagccacccacaa
ccggctgaactctatccaagcatcgatccgaatcactttggtgccgatggaaatccgtgc
tacgaccgcagcacgcatcaaccgcaacgatgtgtgcccgacttcgtaaacgccgctttc
aacctcgatgtgcaagtgaccaacacgtgtggtacgaaacggccaaccaagttctgtgtg
caatctgggcatactggacaacgaagcgtctgtgagacttgtgacaaccgacatgagggt
ttctctcatccggccaaattcctcaccgatttcaatgtgggaaacaacgaaacctggtgg
caatccgacacgatgatggagggcatgcaattcccaaccagtgtgaatctgactctcact
cttggaaaatccttcgacatcacctacgtccgattaaagttcatcagtccacgtccagaa
tcattcactatctacaagaagaccactgccgatgacgattggactccatggcaatattac
tcaggatcctgccgtgctacctacggtatcccagatcgtgcaccaatcttgccaggaaac
gaaaatgttgctcagtgtaccaaagaattctctgacatttccccaatcaccggtggaaat
atcgcgttctccacactcgaaggacgtccatctgcccatattttcgaagaatctgatgtt
cttcaaaactgggtcactgcttctgctatcaagatctccctgaatcgtatgaacaccttc
ggagatgaagtgttcagagatccacaagtattgaagagttattattatgccatctcggat
ttcgccgttggaggaagatgcaaatgcaacggccacgcttccgaatgcgtaggctcatca
tcggttgatggtgagaaccgtcttgtctgcagatgtgaacacaatacccaaggagccgat
tgtaatgagtgcttgccattttataatgatcgcccgtggaaggctggaactgccaatgag
gctaacgagtgtattgcttgcaactgctctcaactctccaacagatgctacttcgaccaa
caactgtttgagcagaccggacacgggggacactgtatcgactgtcaaggaaacacccag
ggagttcactgcgagcagtgtgttgccaaccattggagacgtccaggagagaactattgt
gttgcttgcggatgtaacgagatcggatctctctctactcaatgcgacaatgaaggaaag
tgtcaatgcaaaccaggagttactggacgtttctgtgatcagtgtctggatggatactac
gatttcagtactaatggatgcaagaactgcggatgcgaagcttcgggatcactgaacaat
caaccaagatgtgactcaacatctggatcatgtacctgtaaactcaatgtggaaggacgt
caatgcgacaagtgtaaaccaggatactttgatctttcaactgaaaaccagttcggatgt
actccatgtttctgcttcggtcattcatctatctgtagcactgctgatggatatttcgct
gttaatgtctccagtgttttcgagaaagaaaaggaaaactggaagggacaaaacagaatc
ggactccaagacgccatcttcgctgagctcgacaaagctgtcgctgtctctgataccgac
aactctccagtctatttcgtcgctcctcaacaattcacaggagatcaacgaagcagttac
aaccaggatcttgttttcactctcagagtgaccaaccatgttaccaaccaagacgtcaaa
gacatcatcattgttggagccgatcgtcaggaactgtcgacctccatcactgctcaagga
aacccattcccaagcaatgaaggcaaaacttaccgcttccgtattcacgccgacccatac
tttggatggtatccaagaatcaacgaactcgacttcattggaattctttccaacatcact
gccatcaaaattcgtgggacctactcatacaaagatatcggatacctttccaatgttcac
cttggaagtgccggacttgctccttcagagtcgaacccgaaacaggccacatggatcgag
cattgcgagtgtcttcctggatttgtcggacagttctgcgagtcttgcgagccaggattc
cgtcgtgagaccaagttcggaggaccattcaaccgttgcatcaaatgcgactgccacaat
cactcgaacagttgtgaagctgaatctggatcgtgcatttgcgaacataacactgctgga
gatacctgtgaacgatgtgctcgtggatactacggagatgctcttcaaggaacatcggaa
gattgccaaaagtgtccatgtccaaatgacggaccatgtattcttcacgccgacggagac
gtaatctgtaccgaatgccccaacggatacactggacgtagatgtgacgagtgctctgat
ggattctttggaaatccaaaggacgatatcgagtgtaatgaatgcgcttgtaacaacaac
accgatccgaattctattggaaactgcgacaagattactggagaatgtaaaaagtgcgtg
tacaacacccatggattcaactgcgagaaatgcaaaccaggatactggggagatgctctc
atcgagccaaaaggaaactgccgaccatgtggatgctttgctgctggaacccgccgtcca
aataacgactacactcttttggaatgtgaacaaactgacggacagtgtgaatgtctgcca
aatgtttggggaatgcaatgtgaccaatgtgagagtggattctacaacattacttctgga
cttggatgccaagaatgtggttgcgacccattgggatctgaaggaaacacctgcgacgtc
gtaactggacaatgtctctgcaaaccaggagtcatcggacagcactgcgaccaatgcgca
ccctaccatttcggattcagtgctaacggatgccaaccatgtgattgcgagtacatcgga
tccgaaagccaacagtgcgacgtgaacaatgggcaatgcttgtgtaaggaaaacgtggag
ggaagaagatgcgatcagtgcgctgaaaaccgctatggaattactcaaggatgtctgcca
tgcgatgactgttacactcttattcagagccgtgtcaacaccttcagagagaaggtgaag
agtcttgacaacactctccaagagattatcgagaacccagctccagtgaatgataccaag
tttgatgagaaagtgaaggaaacatctcgcgccgccaccgaagtttgggaagccgttaag
cagaagaccaaagaaggaggtggcactatcaaaaccaagtcaaaagccatcaaggaagag
atcatgactgcattggagaagctcaccaccattgatgattcagtttctcaagcacgtgtt
ggagctgatgctgctgaaaacgacatgagaagatgggaaatcatcattgagaatgcccga
agagaaattgaaaatgttctccactaccttgagacagaaggagatgagagagctcaaatc
gcctacaacgctagccagaaatacggagagcaaagcaagagaatgtcggaattggctcaa
ggtactcgcgaagaagctgagaagcatctcaagcaagctatggagatcgaaaagctctcc
gagttggctattgccaacgccactcaagctaacaaagaagctagtgacgctatctatggt
ggagagcaaatctccaagcagattgctgagctcaaagagaagcaaaaccaaatcaatgag
tctatctcgagaactttggatttggctgaggaacagaagaagactgctgacgaagcaaac
aatctggctgctgtctcccttactaacgtagaggctgtgaagattccaagtgttgatcca
aaggaactgaaaaatgatgtcgctggagtattggaggaagctgaaaaccttgtcgacagc
tcttacaaggagaacgctgccaacgacgagctattcgaagaggttgagagaactgttgct
gattctcgcaacgaacttcagagcgctcaagaccaacagagagtttccgaccaactgatg
cttgaactcgagaaggcgcgtgaaaaaattgtggactctgtcaccaacgctgataagact
ctgaaggacgccgaagcagttcttgcttcccttgaagagttcacttctaagattgagcaa
tccagaaatgacgctgtcgctgaattcgccaatgttgaaagcatcaacaagaagcttgat
ggagttctcgttgctcaggatgccaagagaaattctctcccactcgacagacaattcact
gctgactacagaaaatctgctgatgttctcctggatgaaaccgctgttcttgttgacaag
tacaaggacctgattaacaccgaagtcgacacccaagattccacagaagctatcaacgga
gatattgagcagctcatggaagaattgaccgagtccaaggagaacttagaatactaccgc
aaacaagccgaagatgacaaactgatggctactgaagctgttcgcaaggcgactcttgcc
aagaactctgctattgacgctaactcgaccattctttctgagcaagatgagatcaaaaag
attattgatgctttgaataccatggaagaagtgaacaatgctgaattggatgaactcgag
gaggaacttgacaaacttgaccaaatgttggctcaagccgctctcgcccaagaagtgcca
aacttccaacagtatcgcgctgacgaagatgccaaggtgcagcagctcaagaatgacatc
actgagctccagaaggaggttgtgaatcttgaggaaattcgcgacaacttgccaaccaaa
tgcttcaatgtcatcaatttggagcaagagggacagaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system