KEGG   Caenorhabditis briggsae: CBG11104Help
Entry
CBG11104          CDS       T01054                                 

Definition
Hypothetical protein CBG11104
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cbr  Caenorhabditis briggsae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBG11104
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CBG11104
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CBG11104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 1480 aa AA seqDB search
MAEDGDEVRIIVLEDGEHLESVIRKVEKGWIVRFKRGSSLLGKRVTVFTTVCPNRPLEWS
EGKDHLSVYCQVRCETAGSFRYHFVVEKVPCAENGISENGKSENPESGHGYFLVMPELKI
NGKPLSLDGICCQTYLTKLLGPISEWKNRLRVAHETGYNMIHLTPIHELGISNSSYSLSN
HHQLIQTVGPDTTFENIQSLVEDIERSWGVLTVQDVVWNHAAKNATWLLEHPESAYNCLN
SPHLRPAYIIDRVYHEFGKQVGDGVWKDRGVPPVIENISHVNAIEYLLRAEILPKADLHE
FYQVDLKAMTSLFEMFIKQADGPTKDPLDGETVKILQDPEYRRFGNTVDFERSARIFNRE
RGDAGNEEERIQKCVKSFEEALHQANLNAARESWEVILAGLRAVMGGISYERIAEHGPKK
GRVSPENPLTTDYFLHLEPEMGWRSEQKLAYDPEKSKFLMAFNGWVMSSDPMKNFALKDS
QVYLRRELVCWGDSVKLNYGEKEEDSPFLWQYMREYTQQAARIFHGLRIDNAHGTPIHVA
EKLLKIAREIRPDIYVFAELFTGSEHADNMFVNRLGISSLIREAQSAGDSHEQGRLVYRY
GGDCVGAFKQKSARLAPESIAHGLFLDQSHDNPSPIHTRSAFDILPTAAMLTMASCAVGS
NRGYDELVRDHIHVVHETRPYASWSDEVTSSQGIIAGRKILNNLHTWLAEHGFNQVFVDQ
MNSDIVGITRHNPRSHETVVVVSHTAFSKNYVNWPAGLKHIPIGGVLESVLFEMKLNKQQ
DEWNPENSNFLEGLKIFEMEIRENAGLEEGQMFKLHGGPTGFIELTNFPSGSVIGFKIRP
SDEAASAFEQIHQSIASSPHLDSALSKLTYQSFPTLLFHCESEDYATIEQGGYDVPNFGK
FVYCGLQGLIPVLDKIRDHNDLGHPLCQNLRDGTWLCDYIVGRLAKFPKLLEVSEVIEQL
LKPLERVPYYLRPAYFEVLIAHIYGKARKEALSRMASEIHSSSALIRHLAISTLEFLGYI
PGAGLAPIPESLKLEDEHPSSLAAGLSHFSVGIWRNWGRDTFIALPGCLLATGRFQEARQ
IILSFAGSLRHGLIPNLLAEGIGARYNCRDATWFWLVSIVKYVEMAPNGIAILQDPVRRI
YPKDDTVYGDAEKEERLIDTIYEAIEKHFAGIDFRERNAGPQIDEQMRDEGFRVTVSVSR
TTGFIQGGNRWNCGTWMDKMGSSERAGNKGEPATPRDGAAVELQGLAYRTLRSLADWKKA
GLIERGGVSDDWSWSFWAEKIRRNFEKRFYVEKGATGEFVNRTEILKDSFGSSLGFTDWE
LRCNYGIALAVAPDIMDPKKAWKALDTAEVLLGPLGIKTLDPTDWNYNGYYNNDDDGTNK
VTAKGWNYHQGPEWLFVAGYYLQARLKIGEILGGAEKKYAIRQVQERLGSAYKHLIDSPW
RSLPELTNANGEYCRQSCDAQAWSVGCLMEACVKLNTIDE
NT seq 4443 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagatggtgacgaggttagaattattgtgctcgaggatggcgagcatttggag
agtgtgattagaaaagtcgagaaaggttggatagtgcgattcaagcgtggctcatcgctt
ctcggaaaacgggttactgtattcactacagtatgcccaaaccgccccttggaatggtca
gaaggcaaagaccacctgtcggtgtactgtcaagttcgctgtgagaccgccggctcgttt
agatatcattttgttgtcgaaaaagtgccttgtgctgaaaatggaatctctgaaaatgga
aaatctgaaaatccagaatccggacatggatattttctagtgatgcctgagttgaaaatc
aatggaaagcccctttctttggatggaatttgttgtcaaacgtatttgacaaagcttttg
ggaccgatttcggaatggaagaatcgtctgagagtggcacatgagacaggatataatatg
attcatttgacgccaattcatgagttgggaatctcgaattccagttattcgctgagcaat
catcatcagttgattcagactgttgggcctgacacaacattcgaaaacatccaatccctc
gtcgaagacatcgaacgatcctggggtgttctaacagtccaagacgtcgtctggaatcat
gcggcaaagaatgccacgtggcttttggagcatccagaatccgcatacaactgtttgaat
agtccccatctacgcccggcttatatcattgatcgagtctatcatgaattcggaaaacaa
gttggagatggtgtttggaaggatcgaggagttcctccagtcattgaaaatatctcacat
gtcaatgcaattgaatatcttttaagagctgaaatccttccaaaagctgatcttcatgag
ttttatcaagtggatttgaaagcgatgacaagtctcttcgagatgttcatcaaacaagcc
gacggtccaacgaaagatccattggacggggaaaccgtaaaaattctgcaagatcctgaa
tatcgacgattcgggaatactgtagattttgagagatcagcgagaattttcaatcgggag
agaggagatgcggggaatgaagaagaacgaattcaaaaatgtgtgaaaagcttcgaagag
gctctccatcaggcaaatttaaatgccgctcgcgagtcatgggaagtcattttagccggt
ctacgagccgtcatgggcggaatctcgtacgaacgaatcgctgagcatggaccaaaaaag
gggcgtgtctctccggaaaatccactcaccactgactattttctacatttggaaccggaa
atgggatggagatccgagcagaaattggcgtatgatccggagaaatccaagtttttgatg
gctttcaatggatgggtcatgagcagtgacccgatgaaaaattttgcgttgaaggattcg
caggtctacctccgtcgtgagctggtgtgttggggtgactctgtcaaattgaactacggc
gaaaaagaagaggacagtccgttcctatggcaatacatgagagaatacactcaacaagcc
gcccgtatcttccatggacttcgcattgataacgcccatgggacaccgatccacgtggca
gagaagctgctgaaaatcgcacgagaaatccgaccagatatctatgtttttgctgagcta
ttcacaggatctgagcatgctgataacatgtttgtcaatcgattaggcatctcttcattg
attagagaggcgcaaagtgctggggatagtcatgaacagggtagattggtttatagatac
ggtggcgattgtgtgggagcgttcaaacagaaatccgcccgtctcgctcccgaatccatt
gctcatggcctatttctggatcaatcacacgataatccgtcgccaattcacacgagaagt
gctttcgatattcttccgacggccgcaatgctcacgatggcctcgtgtgcagtgggaagt
aatcgaggatacgatgagctggttcgagatcatatccatgttgtccatgagacccgcccg
tacgcctcatggtccgacgaggtaacctcatctcaaggaatcatcgctgggagaaaaatt
ctgaataatttgcacacatggctcgccgagcacggtttcaatcaggtcttcgtggatcaa
atgaactcggatatcgtcggaatcactagacacaatccacgtagtcatgagacagtagtc
gtggtctctcatacagctttttcgaaaaattatgtaaattggccggctggtttgaagcat
atcccaattggaggcgtccttgaatctgttctttttgaaatgaagctaaacaagcagcaa
gacgaatggaatccggagaattcgaattttctggaaggactgaaaattttcgaaatggaa
attcgagaaaatgccggcttggaggaggggcaaatgttcaaattgcatggtggacccact
ggattcattgagctcactaatttcccatctggatctgtcattggattcaaaattcgacca
tctgatgaggctgccagcgctttcgagcagattcatcaatctatagcctcctcccctcat
ctggactccgccctctccaaactgacctatcaatccttcccgacccttctattccactgt
gaatcggaagactatgcgacaatcgaacaaggcggatatgatgttccgaactttggaaaa
tttgtctattgcggcctacaaggcctaattccagtcctagacaaaatccgggaccacaac
gatttgggccatccactgtgccagaatcttcgagacggcacttggctttgtgattatatt
gttggaagattggcaaaattcccgaagcttctggaagtttctgaagtgattgaacaactt
ctaaaacctcttgaacgtgtaccgtactacttgagacctgcgtactttgaagtactgatt
gctcatatctatggaaaagcgagaaaagaggcgttgagtcgaatggcatcagaaatccac
tcgtcatctgctctaatccgtcacttggccatctcaacactggaattcctcggctatatt
ccaggcgccggactcgcccctattccagaatccctaaagctagaagatgagcatccgtcg
agtctcgctgccggactctctcatttttcagttggaatctggagaaattggggtcgtgac
accttcatcgctcttcccggatgccttctagcgactggacgattccaagaagcccgccaa
atcattctatcttttgctggatcacttcgtcatggtttgataccgaatctgcttgctgaa
ggcatcggagcccgatacaattgtcgagatgccacgtggttttggctggtctccattgtg
aaatatgtggaaatggcaccgaatggaattgcaatccttcaagacccggttcgtcggatc
tatccaaaagatgatacagtttatggagacgcagagaaggaggagagattgattgatacg
atttacgaggccatcgagaaacactttgctggaattgatttccgggagagaaatgcggga
ccacaaattgatgagcaaatgagagatgagggatttagggttactgtaagtgtctctcga
accactggcttcattcaaggcggaaatcgctggaactgcggaacgtggatggacaaaatg
gggagtagtgagcgtgcgggaaacaaaggagaaccggcaacacctcgtgatggagcagcc
gtcgaactacaaggtctcgcctaccgtacccttcgatcgctggccgactggaagaaggcg
gggcttatcgagaggggcggagtcagtgacgactggtcttggagcttttgggcggagaaa
attcggagaaacttcgagaaacgattctacgtggagaagggggctactggcgagtttgtg
aatcgtacggagattttgaaggattcattcgggtcgagccttggattcacggattgggaa
ttgagatgtaattatggcatcgcgttggcagtcgctccagatattatggatccgaagaag
gcgtggaaggcattggatactgcggaggttcttttgggaccgctgggaattaagaccttg
gatccaaccgattggaactacaacggttactacaacaacgatgatgacggtaccaacaag
gttaccgcaaaaggctggaattaccatcagggacctgaatggctgttcgtcgccggttat
taccttcaggctcgtctcaaaattggagaaattcttggaggcgccgaaaagaaatacgcc
atccgtcaggtccaagagcgtctcggtagcgcttacaaacacttgatcgattcgccatgg
agatcgcttcccgagttgacgaatgccaatggggagtactgtagacagagttgtgatgcg
caggcgtggtccgtcggatgtctgatggaggcgtgtgtcaagctgaatacaattgatgaa
taa

DBGET integrated database retrieval system