KEGG   Caenorhabditis briggsae: CBG11321Help
Entry
CBG11321          CDS       T01054                                 

Gene name
Cbr-air-1.1
Definition
C. briggsae CBR-AIR-1.1 protein
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CBG11321 (Cbr-air-1.1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   CBG11321 (Cbr-air-1.1)
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CBG11321 (Cbr-air-1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 327 aa AA seqDB search
MNGKENSAPVETDDQRAEVISLTEDRKPHKMQAKEETCWSLDDFDVGRPLGKGKFGNVFI
SREKKTKRIIALKVLFKSQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVI
LDYASRGELFNVLQAQQGHKVSEVIAARFVRQLANALKYCHSKGVIHRDIKPENLLLDSK
LNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGFA
PFANQTGDKLIARIKECKIYIPSTVSDGAGSLINAIIKKEPSERLPLNDIMAHSWIKEMQ
ENEEIEVQKFLQTLTKTSSRNNSSSNQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaaagagaattccgcgcccgtagaaacagacgaccagagagccgaggttatc
tctctaactgaagaccgcaaacctcacaaaatgcaagcaaaggaagagacatgttggagc
ctcgatgatttcgatgtcggtcggccgcttggaaagggaaaattcggcaacgtcttcatt
tctcgtgagaagaaaacaaaaaggatcatcgcgctgaaagtgctcttcaaatcccagctc
cttcagctcggtgtcagtcatcagttgaagcgagaaatcgaaatccagtatcatttgcgt
cacccgaacattctcacgctctacggatacttccacgatgacaagcgtgtgttcgtcata
ctcgactacgccagccgaggagagctgttcaatgtcctccaggcgcaacagggacacaaa
gtttccgaggtcattgcggccagattcgttcgacaactcgccaacgcattgaagtactgc
cactcgaaaggagtcattcacagagacatcaagccagaaaatcttctcctcgactcgaag
ctcaatcttaagctcgctgactttggatggtcagtggtcgcggatcactcaaaacgacac
accctctgtggaacgatggactacctggccccggagatggtttcgaatcaaccgcacgat
ttcaatgtcgacatctgggccattggaattctcctgtttgagatgctcgtcggattcgct
ccattcgccaaccagactggagacaagttgatcgccagaatcaaggagtgcaaaatctat
atcccaagcacagtgagtgacggagcgggcagcttgataaacgcgataatcaagaaagag
cccagcgagcggcttcctctgaacgacattatggctcactcatggatcaaggaaatgcaa
gaaaacgaagagatcgaagttcaaaagttccttcaaacgctcaccaagacgtcgtcccgt
aacaattcgagcagtaaccaataa

DBGET integrated database retrieval system