KEGG   Caenorhabditis briggsae: CBG11321Help
Entry
CBG11321          CDS       T01054                                 

Gene name
Cbr-air-1.1
Definition
C. briggsae CBR-AIR-1.1 protein
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 327 aa AA seqDB search
MNGKENSAPVETDDQRAEVISLTEDRKPHKMQAKEETCWSLDDFDVGRPLGKGKFGNVFI
SREKKTKRIIALKVLFKSQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVI
LDYASRGELFNVLQAQQGHKVSEVIAARFVRQLANALKYCHSKGVIHRDIKPENLLLDSK
LNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGFA
PFANQTGDKLIARIKECKIYIPSTVSDGAGSLINAIIKKEPSERLPLNDIMAHSWIKEMQ
ENEEIEVQKFLQTLTKTSSRNNSSSNQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaaagagaattccgcgcccgtagaaacagacgaccagagagccgaggttatc
tctctaactgaagaccgcaaacctcacaaaatgcaagcaaaggaagagacatgttggagc
ctcgatgatttcgatgtcggtcggccgcttggaaagggaaaattcggcaacgtcttcatt
tctcgtgagaagaaaacaaaaaggatcatcgcgctgaaagtgctcttcaaatcccagctc
cttcagctcggtgtcagtcatcagttgaagcgagaaatcgaaatccagtatcatttgcgt
cacccgaacattctcacgctctacggatacttccacgatgacaagcgtgtgttcgtcata
ctcgactacgccagccgaggagagctgttcaatgtcctccaggcgcaacagggacacaaa
gtttccgaggtcattgcggccagattcgttcgacaactcgccaacgcattgaagtactgc
cactcgaaaggagtcattcacagagacatcaagccagaaaatcttctcctcgactcgaag
ctcaatcttaagctcgctgactttggatggtcagtggtcgcggatcactcaaaacgacac
accctctgtggaacgatggactacctggccccggagatggtttcgaatcaaccgcacgat
ttcaatgtcgacatctgggccattggaattctcctgtttgagatgctcgtcggattcgct
ccattcgccaaccagactggagacaagttgatcgccagaatcaaggagtgcaaaatctat
atcccaagcacagtgagtgacggagcgggcagcttgataaacgcgataatcaagaaagag
cccagcgagcggcttcctctgaacgacattatggctcactcatggatcaaggaaatgcaa
gaaaacgaagagatcgaagttcaaaagttccttcaaacgctcaccaagacgtcgtcccgt
aacaattcgagcagtaaccaataa

DBGET integrated database retrieval system