KEGG   Caenorhabditis briggsae: CBG11768Help
Entry
CBG11768          CDS       T01054                                 

Definition
Hypothetical protein CBG11768
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cbr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 438 aa AA seqDB search
MRLILLLFLPVWINCFYTSSDGIAELTDSNFDSKVLKSDRIWVVEFYAPHCGHCKSLVPE
YKKAAKLLKGIASIGSIDGTIQKALPSKYGIKGWPTIKIFGLGDKSKPIDYDGPRTAKGI
AEVIQKTIKKTLEERSGGKSKKSEKSSKKSGISGKVVTLTDSNFEKLVLNSKDTWMVEFF
APWCGHCQKLAPEWEKAAKAMAGKIKFGTLDATAHQSISRKFGIQGFPTIKFFAPGSTSS
DGEDYQGGRTSSELISYSESKLEDVVNSKDPEVIEGTSSDSIQETCQNRQLCIFAFLPSI
FDCQAKCRNEKLEILRKVAQNFKKRSFGWAWLEAGAQSDVEKAFEIGDSGYPVVVAMSPS
KLKFATQIGQFSVDGIKEFLNSVTYGKGRVRDVQPARLSGNWLKIVETAPWDGLDKELPI
VEDIDLSDIDLDSSKSEL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgattttgcttctatttctccccgtatggataaattgcttctacacctccagc
gatggaattgctgagctcactgactcgaatttcgattcaaaagttttaaagagcgatcgc
atttgggtggtagagttttacgcgcctcattgtggccactgtaaatcgctggttcccgaa
tacaaaaaagcggcgaaacttttgaaaggaatcgcatcgattggatcgattgatgggacg
attcagaaggcgttaccgtcgaaatacggtattaaagggtggccaacgatcaaaatattc
ggtttgggcgataaatcgaaaccaatcgattatgatggaccaagaactgcaaaaggaatt
gcggaagtgattcagaagacgattaagaagacgttggaggagagatctggaggaaaatcc
aaaaaatccgaaaaatcctcgaaaaaatcgggaatttctggaaaagtagtcactttgacg
gactcgaatttcgaaaaattggttctgaacagtaaggatacttggatggtcgaattcttc
gctccctggtgtggacattgtcagaaattggctccggagtgggaaaaggcggcgaaagcc
atggctgggaagattaagttcggtacactcgacgcaaccgcccatcaatcgatatctcga
aaattcggaattcaaggatttcccacgatcaaattcttcgctccaggatcaacgtcatct
gatggagaggactatcaaggagggcggacgtcatctgaattgatctcgtattcagaatcc
aaactagaagacgtcgtcaattccaaagatccagaagtcattgaaggaacgtcatctgat
tctattcaggagacgtgccagaatcgacaattgtgcattttcgcattcctaccatcgatt
ttcgattgtcaggcgaagtgtcgaaatgagaaattggagattttgagaaaagtggcccag
aatttcaaaaaacggtcgtttggatgggcttggttggaagcaggagcccaatctgatgtt
gaaaaggcttttgaaatcggggattctggctatccggtcgttgtcgcgatgagtccatct
aagctgaaattcgccactcaaattggccaattttcagtggacggaatcaaggaattcttg
aattcggtgacgtatggaaaaggaagagtccgagatgtgcagcccgcccgtttgtctgga
aattggctgaaaatcgttgaaacagctccatgggacggcctggataaggaacttccaatc
gttgaggatatcgatttatcggatatcgatctggattcgtcgaaatcggaactttaa

DBGET integrated database retrieval system