KEGG   Caenorhabditis briggsae: CBG11942Help
Entry
CBG11942          CDS       T01054                                 

Gene name
Cbr-unc-13
Definition
C. briggsae CBR-UNC-13 protein
Orthology
K15293  
protein unc-13
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 1292 aa AA seqDB search
VPRRRKRKRVKIKRSRSCPNLWKCERVPVQMRSKSLTFLRVPKKLVPQKPVKSVRVKIPA
ARCESDSKAAHNKKKQLLDVYKDRGKKSTVLDGDGCSAANAFYKSIDAAPNMNVARNKTS
IPLVSELTMATKRAQAGLANAAKTTFADTELKSHVYKKTLQALIYPISATTPHNFATTTF
QTPTFCYECEGLLWGLARQGLRCTQCQVKVHKCRELLSADCLQRAAEKSSKHGEADRTQS
LVNVIRDRMIIQEQNKPEIFAMIRNIFDVEENMQKQTLKSVKESILEGSSKWSAKITLTV
LCAQGLIAKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRV
WDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHI
SVEIKGEEKVAPYHVQYTCLHEHLFAAHCVDDEVKLPKVKGEDSWKVCFQETGQEIADEF
SMRYGIESIYQAMTHFACLCTKYMCSGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAA
SNFGKERFVKLLDQLHNSLRIDLGAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLE
LVSPPRACTVVSECAKACMQQTYQMMFVACEEQFAINDTSVTFWYEFIDYIMRVIEEDQK
SYAPTLNQFPQDLNVGNLSADTLWTLYKTDLKVALEEHAEKKKCKTPEYMNLYFKVKGFY
FKYISELSNYKNGIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTK
FSNSVVDVFTQLNAALKLLKQMDCPNPEVSADMMKRFSKTLNKVLLAYADMVQKDFPKFA
HDEKLACILMNNVQQLRVQLEKIYETMGGTELDEHIGHVLTILQKKLNAVLDKLSAEFVA
TLEPHIHEQTIKLGMLLVKIKGPQLQKTQVQPEADAVLEPLMDLLEGSLRRYADQCEKTV
LKYILKELWKITIVNMEKRVVLPPLSDKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVK
DMMDIARESEKSLTPKQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLY
TQTTEQLIKTFITSQRQQDLPSQEQPVGEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQ
TSSAFKPFVEVHLVGPHLSDKKRKCATKSKPGNWAPKFNETFHFFLGNEGEPEHYELMFQ
VKDYCFAREDRIVGVGVLQLSAVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDE
VAKDFVRLKTECRYETETVMAASASSQNINRT
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
gtgccacggcgaaggaaaaggaagcgggtgaaaataaagaggtctagaagttgtccgaat
ttatggaaatgtgagagggtaccagtacaaatgcgaagtaaaagtttgacgtttctacgg
gttcccaagaaattggtgcctcagaaacctgtgaaatcagtgcgagtgaagataccagcg
gcacgatgtgaatcggattccaaagcggcgcataacaagaagaaacaattgttggatgtt
tataaagatcgaggaaagaagagcacagtactcgacggcgacggatgctccgccgcgaac
gccttctacaagtccatcgatgcggctcccaacatgaatgtggcacgcaacaaaaccagt
atcccactggtttccgaactcacgatggccacaaaacgagcccaagctggattggcgaat
gcagctaaaacaacgttcgcggacacggaattgaaatcccacgtgtacaagaagaccctt
caagcgcttatctaccccatatcggcgacgaccccccataactttgcaactaccacattc
cagacccccacattctgttacgaatgtgagggactgctgtggggattggcacgtcagggg
ctcagatgcacacagtgtcaggtgaaagttcacaagtgtcgagaacttttgagtgccgac
tgtctgcagagagccgccgagaagtcgtcgaagcacggtgaagcggaccgaacgcagtct
ttggtaaacgttatcagggatcggatgataatccaggaacagaataagccagagattttc
gccatgattcgcaacatcttcgatgtggaggagaatatgcagaagcagacgttgaagagt
gtcaaggagtcgattttggagggaagcagcaagtggagtgcgaagattacgttgaccgtg
ctctgcgctcaagggctcatcgccaaggacaaaaccggcaaaagtgatccgtacgtgacg
gcacaagtgggcaaaacgaaacgacgcacacgaaccatccatcaagagttgaatccggtc
tggaacgagaagtttcactttgaatgtcacaactcgacggaccgcatcaaagttcgtgtg
tgggatgaggataacgatttgaaatcgaaactccgtcagaaattaaccagggaatctgac
gacttcttgggacaaactgtaattgaggtcagaacgttgtccggagaaatggatgtgtgg
tataacctcgagaagcgtaccgacaaatcagcggtttccggtgctattcgtcttcacatt
agcgttgagatcaagggagaggagaaagtggcaccgtatcatgtacagtatacctgtctg
catgaacatctgttcgcggcacactgtgttgatgatgaggtcaaattgccgaaagtcaag
ggggaggacagttggaaggtgtgcttccaggaaactggacaagagattgctgatgagttt
tcgatgcgatatggtattgagagtatctatcaggcgatgacccatttcgcgtgcctttgt
accaagtacatgtgctcaggtgtaccagccgttttgtcaacacttcttgccaatataaat
gcctattacgcccatacgactgccacgtcggcagtctcggctcctgaccgatttgccgct
tcgaatttcggaaaagagcgatttgtgaagctgttggaccaactgcacaacagcttgaga
atcgatttaggagcttataggaatcatttcccgtcgtcgtcgcccgccaaactacaggat
ctcaaatccaccgtagacctgttgacatcgattacgttctttcgtatgaaagttctcgaa
ctagtgagcccaccgcgagcctgcactgtggttagcgaatgcgcgaaagcctgcatgcag
caaacatatcaaatgatgttcgtcgcatgcgaagagcagttcgcaatcaacgacacatcg
gtcacattctggtacgaattcatcgactatatcatgcgagtcattgaagaggatcaaaag
agctatgcgccgacactgaatcagtttccacaggatcttaacgtcggaaacttgtctgcg
gataccctatggacgctgtacaagacggatctgaaggtggcacttgaggagcatgcggag
aagaagaaatgcaaaactccggaatacatgaatttgtatttcaaggttaaaggattctac
ttcaagtatatcagtgagctgagcaactacaaaaatggtattccggagtttccggcgtgg
ttcattccatttgttatggattggctcaatgaaaatgacgagcactcgatggacattttg
agaaatgcatataatgtcgacaaggcggacaatttcccacaaacatcagagcacacgaaa
ttctccaacagtgtcgttgacgtcttcacacaactgaacgctgctctgaagctgctcaaa
cagatggactgtcctaatccagaagtgtcggcggacatgatgaagcgattcagtaaaact
ctcaataaagtgctcctcgcgtacgccgatatggtacaaaaagacttccccaagtttgcg
catgacgagaagttggcgtgtattctgatgaacaatgttcagcagttacgtgttcaactt
gagaaaatctatgaaacgatgggaggtaccgaactcgacgaacacattggacacgtgctt
actatccttcaaaagaagttgaacgcggtgctcgacaagctctccgcagaattcgttgct
acattggaaccccatattcatgagcaaacaatcaaactgggcatgctgctggttaagatc
aagggaccccaactgcaaaagacgcaggtccaaccagaagccgatgctgttctggaacct
ctcatggatcttctggaaggttcgctgagacgatatgcagatcagtgtgaaaagacagtg
ctcaagtacattctcaaggagttgtggaaaataacaattgtgaatatggagaagagagtt
gtactaccccctctgtcagataaggcacttctcaaacaacttccaaatgcaaagatcgga
gatgttacgaagctcatgtctactaatattcaaagtatcaaaggaatgaactctgtgaag
gatatgatggatattgctagagaatcagagaaatcgcttactccgaaacaatgcacggtg
ctggattgtgctttggatgctattaaagacagtttccatgcgtctggaaagggtttgaag
aagtcgttcttcgagaaatcaccggaacttcaatccctgaaatatgctctcagtttgtat
acacagacaaccgagcaattgatcaagacgtttattacaagccagagacaacaagatctt
ccaagtcaagaacaaccagttggagaggtcagtgtacaagtcgatttattcagtcatcca
ggaactggcgagcagaaagtcaccgttaaaatccttgctgccaacgatctccgctggcaa
acgtcatcagcattcaagccatttgtcgaagtccatctcgttggaccacatctctcggac
aaaaaacgcaaatgtgccacgaagagcaaacctggaaactgggctccgaagtttaatgaa
acgtttcatttcttcctcggaaatgaaggagaacctgagcactacgagctcatgttccaa
gtcaaggactactgcttcgcccgtgaagatcgcatcgtgggtgttggtgtccttcagttg
tcggctgtcgttgatcaagcgggatcctgcgcaatgtgggtacaactcggtactcgtctt
cacatcgacgagactggtctcatcttgttgaggattctatcgcaacgacagactgatgag
gtcgccaaagatttcgtccgcctgaaaaccgaatgccgttacgagacggaaaccgtgatg
gccgcatcggcttccagtcaaaacatcaatagaacgtga

DBGET integrated database retrieval system