KEGG   Caenorhabditis briggsae: CBG11972Help
Entry
CBG11972          CDS       T01054                                 

Definition
Hypothetical protein CBG11972
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cbr  Caenorhabditis briggsae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CBG11972
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CBG11972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 216 aa AA seqDB search
MHATSRVGWFWSTPSWQKIIRRMPCRPIVLSGPSGGGKSTILTRAMKEYPNSFAFSVSHT
TRQPRAGEEHGKHYYFTEKEKMQAMIKNGEFLEHATFSGNTYGTSKKTVEEIEKSGKICV
LDIELQGVRNIKNSHLDARYILIRAPSIKLLEERLRARGTETEESLKKRLQHAEEDLVEI
EKNPTLFDKVIVNDDLERAYKEFVDLLREDLEKTKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccacctctcgtgtcggttggttttggtctacgccttcctggcagaaaatcatt
cgcagaatgccgtgccggccaatcgttctttccggaccgtccggtggtggaaaaagtacg
attctgacgagagcgatgaaagaatatccgaacagttttgctttcagtgtgtctcatacc
actagacaaccgagagccggcgaagagcacggaaagcattactacttcaccgaaaaagag
aagatgcaggctatgattaaaaacggagaattcctcgagcacgcaacattcagtgggaac
acttatggaaccagcaaaaaaactgtcgaggaaatcgagaaaagtggaaaaatttgtgtc
ttggacatcgagttgcaaggagttcgtaatatcaaaaacagtcatctggatgctagatac
atcttaattcgtgctccatccattaagctcctcgaagaaaggctgagagctcgaggaact
gaaaccgaggaaagtttgaaaaaacgtctgcaacacgcagaagaggatctcgttgaaatt
gagaagaatccgacacttttcgataaagtgattgtgaacgacgatcttgagcgtgcttac
aaggaattcgttgaccttcttcgtgaggatctcgaaaaaacgaaaaaataa

DBGET integrated database retrieval system