KEGG   Caenorhabditis briggsae: CBG12356Help
Entry
CBG12356          CDS       T01054                                 

Definition
Hypothetical protein CBG12356
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cbr  Caenorhabditis briggsae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CBG12356
   00670 One carbon pool by folate
    CBG12356
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CBG12356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 189 aa AA seqDB search
MRKMNMIVAMDTEGGIGKNGVLPWRIRKDMQYFAAVTKKVSDPAKRNAVLMGRKCWESIP
ESRRPLPGRLNIVLSRQLEKQNTDNLIVVNSLESALKLLSEAPFVDSIETIWNIGGAEIY
DLALRENLVDEIHLTRIHKNFEADVHLKSLDFNKLKKIIDAEASSENSELFEENGLQFEI
GKWKIIEHC
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaatgaatatgatagtcgctatggatacagaaggaggaatcggtaaaaacgga
gttctaccatggagaatcagaaaagatatgcagtactttgcagctgtcactaaaaaagta
tcagacccggcaaagaggaatgcagtactgatgggccggaaatgctgggaaagcattcca
gaatcccgtcgtcctcttcctggtcgcttgaacatagttctcagtcgccagcttgaaaaa
caaaacaccgataacttgattgtagtaaattcgcttgaatctgctttgaaacttctctca
gaagcacccttcgttgattctattgaaactatttggaatatcggaggagctgaaatctat
gatcttgcgcttcgggaaaatttagtcgacgagatccatttgacacgaattcacaaaaat
ttcgaggctgatgttcacctcaaatcgcttgatttcaacaaactgaagaagattatcgat
gctgaagcgtcttcggaaaactcggaactttttgaagagaatggcctacaattcgagatt
gggaaatggaaaatcattgaacactgctaa

DBGET integrated database retrieval system