KEGG   Caenorhabditis briggsae: CBG12484Help
Entry
CBG12484          CDS       T01054                                 

Definition
Hypothetical protein CBG12484
Orthology
K10739  
replication factor A2
Organism
cbr  Caenorhabditis briggsae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CBG12484
   03420 Nucleotide excision repair
    CBG12484
   03430 Mismatch repair
    CBG12484
   03440 Homologous recombination
    CBG12484
   03460 Fanconi anemia pathway
    CBG12484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 265 aa AA seqDB search
MNGKRQSLQDQFEANMDFSSGDGWASHDVSQGRKIHSVGVIMEKVSEDGKTTYTLHDPEK
SEKTFYAIQFGQYDDGGSKFVAPGLIEDQRVRVMGKLKNVGGEKMILIYYLQQLGDDKDY
QIFKLEAEVAELFFKKNLLEKMRTGNTNGWTGMLAPPMTRYFDNFDANSFMHSEISKTPA
APIKIEQKLIQATPKTSSAFKAKIRACIRSEAERGTYGNDDGVPFTKIMSRMNGVSEQAL
REILTEMENSGMIYAAKHEEYMSLY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcaaacgacaaagtcttcaggatcaattcgaagcaaacatggatttcagcagc
ggtgacggatgggcctcgcacgatgtttcgcaagggagaaagattcattccgtcggtgta
atcatggagaaggtttcggaagacggaaaaaccacttatactcttcacgatccagagaaa
tccgagaagacgttctatgctattcagtttgggcaatatgatgacggaggatcaaagttt
gtggctcccggtttgatcgaggatcaaagggtacgagtgatgggaaagcttaaaaacgtc
ggtggcgagaaaatgattctcatatattacctccaacaattgggcgacgataaggactac
caaattttcaagcttgaagctgaagttgctgagttattcttcaaaaagaatttgcttgaa
aaaatgcggactggaaacaccaatgggtggactgggatgctggctccaccaatgaccaga
tacttcgataatttcgatgcaaattctttcatgcactcggaaatttcaaaaactccagct
gctcctatcaaaatagaacaaaaactcatccaagcaactcctaaaacatcatctgcgttc
aaagcgaagattcgagcttgcatcaggtcagaagctgaacgcggtacgtatggcaacgac
gatggtgtcccattcaccaaaattatgagcagaatgaatggcgtgtcagaacaagctctt
cgtgaaatcctcactgaaatggagaacagtggaatgatctacgccgctaagcacgaagaa
tatatgtctctgtattaa

DBGET integrated database retrieval system