KEGG   Caenorhabditis briggsae: CBG12562Help
Entry
CBG12562          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG12562
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00062  Fatty acid elongation
cbr00071  Fatty acid degradation
cbr00280  Valine, leucine and isoleucine degradation
cbr00310  Lysine degradation
cbr00380  Tryptophan metabolism
cbr00410  beta-Alanine metabolism
cbr00640  Propanoate metabolism
cbr00650  Butanoate metabolism
cbr01040  Biosynthesis of unsaturated fatty acids
cbr01100  Metabolic pathways
cbr01200  Carbon metabolism
cbr01212  Fatty acid metabolism
Module
cbr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cbr_M00085  Fatty acid biosynthesis, elongation, mitochondria
cbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CBG12562
   00650 Butanoate metabolism
    CBG12562
  Lipid metabolism
   00062 Fatty acid elongation
    CBG12562
   00071 Fatty acid degradation
    CBG12562
   01040 Biosynthesis of unsaturated fatty acids
    CBG12562
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBG12562
   00310 Lysine degradation
    CBG12562
   00380 Tryptophan metabolism
    CBG12562
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBG12562
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     CBG12562
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CBG12562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_Gly3P_dh_N Pyr_redox_2 NAD_binding_2 Methyltransf_31 FAD_binding_3 Ribosomal_L27e
Motif
Other DBs
NCBI-GeneID: 8582072
NCBI-ProteinID: XP_002640077
WormBase: CBG12562
UniProt: A8XG18
Position
I
AA seq 755 aa AA seqDB search
MLSRLVHQSSSTLRTHVTFRLFSQSSPAMQSTLRVEKQGEVAVVKIDLPNTKENVLNKAL
SADMKATFDKLQADESVKSIVVMSGKPNSFVAGADIQMLKAEKSAAGIEALSRDGQEQFF
RIEKSQKPVVAAIMGSCMGGGLELALACHYRIAVNDKKTQLAVPEVMLGLLPGAGGTQRL
PKLTTVQNVLDLTLTGKKIKADKAKKIGIVDHVIQPLGDGLGPAAENTHKYLEEVAVKTA
KDLAEGKLKVNRDKGFIHKATQAVMTNSLFLDNVVLKMAKDKLMKLTAGNYPAPLKILDV
VRTAYVDPRKGYEAEAKAFGELSQTFQSKALIGLFDGSTDAKKNKYGQGLPVNEVAVVGA
GLMGAGIANVTIDKGVRTVLLDANPAGVERGQNQIATHLNGQVKRRKINKLEKERIYNHL
VPTVDYAAMKNADLVIEAVFEDLQLKHKVIKQIESVVGPNTIIASNTSALPIKDIAAASS
RPDKVIGMHYFSPVEKMQLLEIITHEGTSKETLATAAQLGLKQGKLVVVVKDCPGFFVVR
CLGPMMSEVVRLLQEGVDPAELDKLTTKFGFPVGAATLADEVGLDVAEHVAQFLGKALGP
RVRGGSADLLSELVNAGHKGRKTGKGIFVYGDGKKGSKKVNEEATKLLQKYKLTPNATVS
SPEDRQLRLVSRFVNEALLCLEEGVLASPSDGDIASVFGIGFPPFWGGPFRFVDLYGADK
LVASMEKFAGAYESAQFTPCQLLKDHAKSGKKFYN
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgcgtcttgtccatcagtcgtcgtcgacgcttcgcacgcacgttacattccgt
ctgttctcgcagtcatcaccagctatgcagagtactcttcgcgttgaaaaacaaggagaa
gtggccgttgtgaagattgatttgccgaacacgaaagagaatgtgctcaacaaagctcta
tctgccgatatgaaggcaacttttgacaaacttcaagccgatgaaagcgtcaaatcgatt
gttgtcatgtctggaaagccaaacagttttgttgctggagctgatattcagatgctgaag
gctgagaagagtgctgctggaatcgaagctctctcccgcgatggtcaagaacagttcttc
aggatcgagaagagccagaagccagtagtcgcagctatcatgggaagttgtatgggtgga
ggactcgagttggctctcgcttgccactaccgtattgctgttaacgataagaagacacaa
ttggcagttccagaagtgatgcttggtctgttgccaggagccggaggaactcagagactt
ccaaaacttactactgttcaaaacgtgctcgacctgactttaactggaaagaaaatcaaa
gctgataaggctaagaaaatcggaatcgtcgatcatgtaatccaaccacttggagatgga
cttggacctgctgctgaaaacacgcacaagtatttggaagaagtggctgtaaaaacggcg
aaagaccttgccgagggaaagctaaaggttaacagagacaaaggattcatccataaggcc
acccaagctgtaatgaccaactcattgttcctcgataatgttgttctcaaaatggctaag
gataaactgatgaaattgaccgctggaaactatccagccccactcaagattctcgatgtc
gttcgcactgcctatgtagatccaagaaagggatatgaagctgaagcaaaggctttcgga
gaactttctcaaaccttccaatccaaagcgttgatcggacttttcgacggatcaacagat
gccaaaaagaacaagtatggccaaggtctgccagtgaatgaggtcgctgttgttggagcc
ggacttatgggtgctggtatcgctaacgtcactattgacaaaggtgtccgtaccgtgctt
cttgatgctaatccagcaggagttgaacgaggacaaaatcaaattgctacacatttgaat
ggacaagtcaaaagaagaaagatcaacaagttggagaaagaacgcatctacaatcacctt
gtcccgactgtcgattatgctgcaatgaagaacgctgatcttgtcatcgaagccgtattc
gaggatcttcaactcaagcacaaggttatcaagcagatcgagagcgtggttggaccaaac
acaatcatcgcttcaaatacttctgctctcccaattaaggatattgctgctgcttcatcg
agaccagataaggtaattggaatgcattatttctcaccagtggaaaagatgcaattgttg
gaaatcattacccacgaaggaacttcgaaggaaacccttgcaacagctgctcaacttggt
cttaagcaaggaaaacttgtcgttgtcgtcaaggattgccccggattcttcgttgttcgt
tgtctcggaccaatgatgtctgaagttgttcgactcctacaagaaggtgtcgatccagct
gaactcgacaaacttaccactaaattcggattcccagttggagcagccaccttggccgat
gaggtcggacttgatgttgctgagcacgtcgctcaattcctcggaaaggctctgggccca
cgtgttcgtggaggatctgctgatttgttgtctgagctggtgaatgctggtcataaggga
cgcaaaaccggaaagggaatcttcgtttatggcgatggaaagaagggaagcaagaaggtg
aacgaggaagctacgaagttgcttcagaagtacaagttgacgccgaatgccacagtgtca
tcaccagaagatcgccaacttcgtcttgtctcccgattcgtcaacgaagccctcttgtgt
cttgaagaaggagtactcgcttcgccatctgatggagacattgcttcagtattcggtatt
ggattcccaccattctggggaggtccattccgcttcgtcgatctctacggagctgataag
ttggttgcttctatggaaaagttcgctggagcttatgagtctgctcagttcaccccatgc
caacttctcaaggatcatgccaaaagtggaaagaaattctacaattaa

DBGET integrated database retrieval system