KEGG   Caenorhabditis briggsae: CBG12562Help
Entry
CBG12562          CDS       T01054                                 

Definition
Hypothetical protein CBG12562
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
cbr  Caenorhabditis briggsae
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBG12562
   01212 Fatty acid metabolism
    CBG12562
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CBG12562
   00650 Butanoate metabolism
    CBG12562
  Lipid metabolism
   00062 Fatty acid elongation
    CBG12562
   00071 Fatty acid degradation
    CBG12562
   01040 Biosynthesis of unsaturated fatty acids
    CBG12562
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBG12562
   00310 Lysine degradation
    CBG12562
   00380 Tryptophan metabolism
    CBG12562
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBG12562
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     CBG12562
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CBG12562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 755 aa AA seqDB search
MLSRLVHQSSSTLRTHVTFRLFSQSSPAMQSTLRVEKQGEVAVVKIDLPNTKENVLNKAL
SADMKATFDKLQADESVKSIVVMSGKPNSFVAGADIQMLKAEKSAAGIEALSRDGQEQFF
RIEKSQKPVVAAIMGSCMGGGLELALACHYRIAVNDKKTQLAVPEVMLGLLPGAGGTQRL
PKLTTVQNVLDLTLTGKKIKADKAKKIGIVDHVIQPLGDGLGPAAENTHKYLEEVAVKTA
KDLAEGKLKVNRDKGFIHKATQAVMTNSLFLDNVVLKMAKDKLMKLTAGNYPAPLKILDV
VRTAYVDPRKGYEAEAKAFGELSQTFQSKALIGLFDGSTDAKKNKYGQGLPVNEVAVVGA
GLMGAGIANVTIDKGVRTVLLDANPAGVERGQNQIATHLNGQVKRRKINKLEKERIYNHL
VPTVDYAAMKNADLVIEAVFEDLQLKHKVIKQIESVVGPNTIIASNTSALPIKDIAAASS
RPDKVIGMHYFSPVEKMQLLEIITHEGTSKETLATAAQLGLKQGKLVVVVKDCPGFFVVR
CLGPMMSEVVRLLQEGVDPAELDKLTTKFGFPVGAATLADEVGLDVAEHVAQFLGKALGP
RVRGGSADLLSELVNAGHKGRKTGKGIFVYGDGKKGSKKVNEEATKLLQKYKLTPNATVS
SPEDRQLRLVSRFVNEALLCLEEGVLASPSDGDIASVFGIGFPPFWGGPFRFVDLYGADK
LVASMEKFAGAYESAQFTPCQLLKDHAKSGKKFYN
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgcgtcttgtccatcagtcgtcgtcgacgcttcgcacgcacgttacattccgt
ctgttctcgcagtcatcaccagctatgcagagtactcttcgcgttgaaaaacaaggagaa
gtggccgttgtgaagattgatttgccgaacacgaaagagaatgtgctcaacaaagctcta
tctgccgatatgaaggcaacttttgacaaacttcaagccgatgaaagcgtcaaatcgatt
gttgtcatgtctggaaagccaaacagttttgttgctggagctgatattcagatgctgaag
gctgagaagagtgctgctggaatcgaagctctctcccgcgatggtcaagaacagttcttc
aggatcgagaagagccagaagccagtagtcgcagctatcatgggaagttgtatgggtgga
ggactcgagttggctctcgcttgccactaccgtattgctgttaacgataagaagacacaa
ttggcagttccagaagtgatgcttggtctgttgccaggagccggaggaactcagagactt
ccaaaacttactactgttcaaaacgtgctcgacctgactttaactggaaagaaaatcaaa
gctgataaggctaagaaaatcggaatcgtcgatcatgtaatccaaccacttggagatgga
cttggacctgctgctgaaaacacgcacaagtatttggaagaagtggctgtaaaaacggcg
aaagaccttgccgagggaaagctaaaggttaacagagacaaaggattcatccataaggcc
acccaagctgtaatgaccaactcattgttcctcgataatgttgttctcaaaatggctaag
gataaactgatgaaattgaccgctggaaactatccagccccactcaagattctcgatgtc
gttcgcactgcctatgtagatccaagaaagggatatgaagctgaagcaaaggctttcgga
gaactttctcaaaccttccaatccaaagcgttgatcggacttttcgacggatcaacagat
gccaaaaagaacaagtatggccaaggtctgccagtgaatgaggtcgctgttgttggagcc
ggacttatgggtgctggtatcgctaacgtcactattgacaaaggtgtccgtaccgtgctt
cttgatgctaatccagcaggagttgaacgaggacaaaatcaaattgctacacatttgaat
ggacaagtcaaaagaagaaagatcaacaagttggagaaagaacgcatctacaatcacctt
gtcccgactgtcgattatgctgcaatgaagaacgctgatcttgtcatcgaagccgtattc
gaggatcttcaactcaagcacaaggttatcaagcagatcgagagcgtggttggaccaaac
acaatcatcgcttcaaatacttctgctctcccaattaaggatattgctgctgcttcatcg
agaccagataaggtaattggaatgcattatttctcaccagtggaaaagatgcaattgttg
gaaatcattacccacgaaggaacttcgaaggaaacccttgcaacagctgctcaacttggt
cttaagcaaggaaaacttgtcgttgtcgtcaaggattgccccggattcttcgttgttcgt
tgtctcggaccaatgatgtctgaagttgttcgactcctacaagaaggtgtcgatccagct
gaactcgacaaacttaccactaaattcggattcccagttggagcagccaccttggccgat
gaggtcggacttgatgttgctgagcacgtcgctcaattcctcggaaaggctctgggccca
cgtgttcgtggaggatctgctgatttgttgtctgagctggtgaatgctggtcataaggga
cgcaaaaccggaaagggaatcttcgtttatggcgatggaaagaagggaagcaagaaggtg
aacgaggaagctacgaagttgcttcagaagtacaagttgacgccgaatgccacagtgtca
tcaccagaagatcgccaacttcgtcttgtctcccgattcgtcaacgaagccctcttgtgt
cttgaagaaggagtactcgcttcgccatctgatggagacattgcttcagtattcggtatt
ggattcccaccattctggggaggtccattccgcttcgtcgatctctacggagctgataag
ttggttgcttctatggaaaagttcgctggagcttatgagtctgctcagttcaccccatgc
caacttctcaaggatcatgccaaaagtggaaagaaattctacaattaa

DBGET integrated database retrieval system