KEGG   Caenorhabditis briggsae: CBG12850Help
Entry
CBG12850          CDS       T01054                                 

Gene name
Cbr-let-363
Definition
C. briggsae CBR-LET-363 protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cbr  Caenorhabditis briggsae
Pathway
ErbB signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cbr04012]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cbr04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 1563 aa AA seqDB search
MLNGGGIDEQTIQLASKALAFLITTCKTYAAELVDRCLDHCQEWLHHVPSYQPPVQNQKD
LTLIEQRRLASAHLSREIALATPTAFFLRVNLFFKYIFFAIKDKQVLVRLAGIDALHTVL
TIVHNEKPRIKPNECFSEALTANTNHQSSDIHDKWHSVALILNELLRISDSRFEMVRCES
SNFVKQKYLREDEDDGVEWLCLSKQPVIVESVTSRKLVVENFSKIIDCVRQMIPLANKVQ
NKQMPGIHLNTVLMQLLPRICAFPQSDRTFQTLAYDTAFHVLQKNSIGAPALGMMMLHNP
DVHSNRIEATINFISAEIKKVTTSSDALDSFFTFLFLFVDSYHEKVTAQIKAIIPQLMDI
PLSRSLANVLKMIMMRIPKLRLNVQDGVMASVYHTLTGLPIPPKSEPTGRPPSPKLILQR
AIEEPKELQRIVLAVDVLGEFYFSRGALQRIMQYVADYYLTADNVEIRLAAVSSCCEMVV
PFVGVYKKVTTDKRNSLLQTIYGVLRAVCSVIVNDPDVRVRMQVISCFGQMPRPFLAHLA
QPEMLEVQFMALHDEKLEMQQACVTLLGRLAELNPALVLPRLRLMLLETLSQMMQSGQAR
LEQHSAKMIAQLAKQSPKFMRPYVGSLMVALIPKMRNDQKYAEVTAQVLHAISEISVIGG
AEIVKNLKPLFEKLTHMINDSSNLHKREAALRAIGGICRSTAYVVDPYRDYPTLLDDLLR
ILKTVMSNTMRREVIKTLGILGAIDPYTHKVFTGSVQSATAISTALSLPMNAEDSKDPRQ
DIIHWFNYEKCTLDEFYPAITIANLMIMMQDEDSQNFAEIAQAIVTIFRSLGEMAPLYTE
QVVPRLIEVCRKTTEQSNHGTNREFFLQQLAIFVAIIKKHAAPYMPAIFTIIADAWKEDI
SVKMVVIQVLTEMGTAIGNDFSKYTGELIPYLLTVLQTDKTKERVLTVKVMESIRPLTYC
IVQHLHLVLPPILIILDDISLKLSIRQTALDTVLHMTQQVDVSAYAPRMMQSWHHNIKVA
EMRDKLLLLLIEIIKQLGKFFDIFKRGVDQKLREHALDKSVHYETYRKLAQRAQMSRDVI
TSSVFAGSNGNLQSAQAAIRGDPGNIYLNNELHERLLNGSMDSANSRHGNRDDYYQFGLE
DKKETPKVAPTTARSTSELVTIQITKQRLNKDLVMSQWKNEHLTSKDEWLQWLVKIRIGF
LKSGSSPSLRAASSLGDQYPHLARDLFPAAFMSVWTELDSEVQKDLTACLLRAVSTGIPE
LIQTILNLAEFMDHSEKGPLPITHDVLGMWAEQTKAFAKACRYKEMSVLKSSETAPMTFR
RKITLRPNDCQSLITYANKLNVQEEAAGVVRYAERNDMNFQRRGRWYEKLNEWEKALDAY
MEEKNSCTNLQNLDKNDVETPEKAAAAEEAKMHEMRCLEALARWDELNAKSAIWAEQRSQ
RSDSIRDEINKKQLDHKMAVIAARGAWAVDNWERMAEYVSVISENTQDGAMLRAVVAVHN
DENTKAMGLIEKVREMIDSELTAMANESYERAYIPMVSVQQMAELEEAIEYKSLFIKHID
KNL
NT seq 4692 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgggggcggaatagatgagcaaactattcagttggcttctaaagcactggcc
tttttgattacgacatgcaaaacgtacgccgccgaactagttgatcgatgtctggatcat
tgccaggaatggcttcaccacgtgcccagttaccagccacctgtgcagaatcagaaggac
ttgacactaatcgaacaacgccgacttgcctctgctcatctgtctcgggagatagcactc
gccactccaactgcctttttccttcgtgttaatctatttttcaagtatatcttctttgct
atcaaagataagcaagtgctggttcgtcttgctggaatcgacgcgttgcatacagtactg
acgattgttcacaacgagaagccaagaataaaaccgaatgagtgcttcagcgaggctctg
acggcgaatacgaatcatcaatcgtcggatattcatgacaaatggcactcggtcgcattg
attctgaatgaactgttgcgcatatcagactcaagattcgagatggttcgatgtgaatct
tcgaatttcgttaaacagaaatatctgagagaagacgaagacgatggtgtagaatggctg
tgtctatcgaaacaaccagtcattgtagaaagtgtcacatcgcgaaaattggttgttgag
aatttctcaaaaataattgattgtgtccggcaaatgattcctcttgcaaataaggttcaa
aacaaacagatgcctggcattcacctgaatacggttctcatgcaacttctccctagaatc
tgtgcgtttccacagtcagatcgcactttccagacactcgcgtatgatactgcattccat
gtccttcaaaaaaactccattggtgctccagcactcggcatgatgatgcttcataaccca
gatgtacattcgaatcgaatcgaggcaactatcaatttcatttccgccgaaataaagaaa
gttacgacatcttctgacgctctcgacagtttcttcaccttcctctttctcttcgtcgat
tcttatcatgagaaagtcactgctcagatcaaagccatcattccccaactcatggatatt
ccactatcccgatcattggcaaatgttctcaaaatgatcatgatgcgaattccgaaactc
aggttgaacgtacaagacggtgtcatggcttccgtatatcacacacttactggacttcca
attccaccgaaatcagaaccaactggacgaccaccaagtcctaagctcatcttgcagaga
gcgatagaggagccaaaagagcttcaacgcattgttcttgctgtcgatgttctcggagag
ttttatttctcaagaggagctctgcagagaattatgcagtatgtggcagattactatctg
actgcggacaacgtggaaattcggcttgccgctgtttcttcgtgctgtgaaatggttgtt
ccgttcgttggagtctacaagaaagttacaactgacaagagaaacagtctccttcaaacg
atttatggagttctccgtgctgtgtgttctgtaattgtgaacgatccagatgttcgtgtt
cgaatgcaagtcatcagttgcttcgggcaaatgccccggccgttcctcgctcatctcgct
caaccagaaatgcttgaagttcaattcatggctctgcacgatgagaagctcgaaatgcaa
caggcttgtgtcacacttctcgggcgtcttgcagaattgaatcctgcattggttttgcca
cgtcttcgcttgatgcttctggaaacgctgagtcaaatgatgcagagtggacaggcgaga
ttggagcagcactcagcgaaaatgattgcgcagttggctaaacaaagtccgaagtttatg
agaccatatgtgggatcccttatggtagcattgattccaaagatgagaaatgatcaaaag
tacgccgaagtgacagctcaagttctacatgcaatcagtgagatttcggtgattggtgga
gcagaaatagtcaagaatctgaagccgttgtttgaaaaactgacacatatgatcaatgat
tcgagtaaccttcataaaagagaggctgctctccgagcaattggtggaatatgtagatca
actgcctacgtggtagacccgtatcgagactatccgacacttctggatgacctacttcgg
attctgaagacagtaatgtcgaacacaatgcgtagagaagttatcaagactcttggtatc
cttggagccatcgatccatacacccataaagttttcactggatccgtacaaagcgcaacc
gctataagcacagctttgtcacttcccatgaacgcagaagactcgaaagatccccgacaa
gacattatccactggttcaactacgaaaagtgtactcttgacgagttctatccagcgatc
acaattgcaaatctaatgattatgatgcaggacgaggactcacagaactttgcggaaatc
gctcaagccatagtgacaatcttcagaagtttgggagaaatggcaccgttgtacacagag
caagtagtaccgagactcatagaagtgtgtcggaaaacaacggaacagtcgaatcatggc
actaacagagagttcttccttcaacaattggcaatctttgtggcaattataaagaagcat
gcggcaccgtatatgccagccatcttcacgatcattgctgacgcttggaaggaagatatc
tcggtgaaaatggttgtgattcaagtgctgaccgagatgggaactgcgattggaaacgat
ttcagcaagtatacgggagaattgataccgtatcttttgactgttcttcaaactgataaa
accaaagaacgagtgttgactgtgaaagtgatggaatcaattcgaccactcacttattgt
attgtccagcatcttcatctagttctccctccgattcttataatccttgacgacatttct
ttgaaattatcaattcgtcaaacagctctggatactgtgctccatatgacacaacaagtc
gatgtatctgcttatgctccaagaatgatgcagagttggcatcacaatatcaaagttgct
gaaatgagagacaagttgcttctattgctcattgagataatcaaacaacttggaaaattc
tttgatattttcaagcgaggagtcgatcagaaactccgtgagcatgctctggacaagagt
gttcattacgagacgtatcgaaaattagctcaaagagcacaaatgtctcgcgacgttatc
acatcgtccgttttcgctggatccaacggaaatttgcaatcagcacaagcggcgattcga
ggagatcctggaaacatttacttgaataatgagctgcatgagagacttctgaatggatca
atggattctgcaaacagccgacatggtaacagagatgattattatcagtttggattggaa
gataaaaaagaaactccaaaagtggcaccaacgactgctcgatcaacaagtgaacttgtt
actatccagatcacaaagcaacgtctcaataaagatttagtgatgtctcagtggaaaaat
gagcatttgacatcgaaagacgagtggttacaatggctggtgaagattcgtataggattc
ttgaagagtggaagttctccatcactccgtgctgcttcatcccttggagatcaatatcct
catctggcacgtgatctcttcccagcagcattcatgtccgtgtggactgaattagattct
gaagttcagaaggatcttaccgcttgtcttcttcgagcagttagcactggaattcccgaa
ctgattcaaacgattttgaatctggcagagttcatggatcactctgagaaaggaccactc
cccataacccatgatgttctcggaatgtgggctgaacagacgaaagcgtttgcgaaagca
tgtagatataaggagatgagtgtgctgaagagctctgaaactgcaccgatgacgttcaga
agaaagatcacactgcgtccaaatgattgccaaagtcttatcacctacgctaacaagttg
aatgttcaagaagaagctgctggagtcgttcggtacgctgagagaaacgacatgaatttc
caacgacgtggtcgttggtacgagaagttgaatgagtgggagaaggcgttagatgcatac
atggaggaaaagaactcgtgtacgaatctacagaatctggataagaatgacgtcgaaacg
ccagaaaaggcagcagccgctgaagaggctaaaatgcatgagatgagatgtttggaggcg
ttggcacgatgggatgagttgaacgcgaaatcggcaatatgggcggagcagagatcacaa
cggagtgattcgataagagatgagattaataagaagcagttggatcataaaatggcagtc
attgcggcgagaggagcatgggctgtggacaattgggaacgaatggctgaatatgtgtcg
gtaatatcagagaatacgcaagatggagctatgcttcgagcagttgtcgctgttcataat
gatgagaatacaaaagcgatgggattgatcgaaaaagttcgcgagatgatcgacagtgag
ctgacagctatggcaaatgagagctacgaaagagcctatattccaatggtttcagttcaa
cagatggctgaattagaggaagctattgagtacaagtctttatttatcaaacacatagac
aaaaatctttaa

DBGET integrated database retrieval system