KEGG   Caenorhabditis briggsae: CBG13344Help
Entry
CBG13344          CDS       T01054                                 

Definition
Hypothetical protein CBG13344
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CBG13344
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG13344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 1339 aa AA seqDB search
MVRVNDSNDTNTSSEHEDSSSNYVRLAGNGLPGGEQQASSSGVAAAPTNENSSPGRSNQL
ALPSSSTAATTSSSQYVIPLDENSHRYVGLVNQAMTCYLNSLVQSLYMTPEFRNAMYEWE
YVQLPAHIKEQRKKAEQSIPCQLQKLFLLLQTTENDSLETKDLTQSFGWTSNEAYDQHDV
QELCRLMFDALEHKWKGTKHEKLIQDLYRGTLEDFVACLNCGRESVKTDYFLDLSLAVKP
FGAIHAYKSIEEALNAFVQPELLNGSNQYMCENCKSNQDAHKGLRITQFPYLLTIQLKRF
DFDYNTMHRIKLNDKMTFPDVLDLNEYVSKEKRPAPTPSATTTTTTSPPKSAWKTIPAKD
EDDDMELGSPNAKRSTPGNQSPNRYSSRGDENVIVGQPIDHESVESIMKTNGEDVYELFS
VMVHSGNAAGGHYFAYIKNLDQDRWYVFNDTRVDFATPSEVEKSFGGHPSGWNQSNTNAY
MLMYRKIDRKRNASFILSNQLPQHIKDSREKWKRLEQEAEEERLRKLSLIQVYVNINYPF
PSYAHLPEKKQLDLTPQKYQIADDFCEYKIEISREQPIKSVFQCAFDFFNERARAYNLPF
SRNNSRLIYVEHGQLEMDFRSPKDMEKKLRSVFSSHHGEPISMYGVHFILDVRIGSSFFN
IDIQNRMTIKVQRVDIGKKTTANELTIVISGDEKMLKVKQWIGTQFRDDIRDVLEARVVL
EAASSRCEFMLIDSQHNSKEFRSLISQHMGHATPTLYYDGGMSTMITEESKEATIADRKL
PFEKSQMYQILDRKCFSTFVKVRLPSQDEVEKAASTKNAFQGPSWEETLAIMKAEDRLWN
EPRAAAVEVMSTVSRAETTDAVTEVDDEPIPSGRGSTASMRSVSMDDIEGDIGISGSLCN
NTPQMSPCVSEGDDIDEKALDGKSQLMADYMQKTSPEFYYNRDPQSPVNKNLKIALHEET
PSEALSAVSSGQSTLVPSTSNQALSSMARSAIDEAFDAKITTVFSHENYHKLDVDSRMRV
VEFKKWVAEQLNMDKDQFVIVKHASDDGSDTGYETNFMDDETVSGAFQSCFISIKLRAPL
KQDEKMIQVILFDMLENQRDNWKPLFELPVSQSTVIGDILLQCIRMYNEVYGEELTPKAV
RLRDVSTTGHYNAKAILNPNDTLEKRGYNWCSHIYMQIVTDEAVLGKPGDPILVRRFRPS
TVEVSPTHEVLVDSNAENPVLSFMEALTKVSGIPLDRLAITEPKEFNWQKWPFVKSRLDM
LENKVAFAKDLHLNYPSPKDFVEKTGSRVLYYKDSEEEPRILTEDERKQIKIKENGQSAN
ANRRKERPLRIQMSSVCEG
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atggtacgggtgaacgactcaaacgacacaaataccagttccgaacacgaagactcttca
tcaaactacgtacggttggctggcaacggtctcccgggtggcgagcaacaggcaagctca
tccggtgtagccgctgcaccgacgaatgagaatagcagtccaggaagatcgaatcagctt
gctttgccctcctcgtcaacggcagcaaccacatcttcaagtcaatatgtgattcctctt
gatgagaacagtcacagatatgttggacttgtcaatcaggcgatgacgtgctatctcaac
agtctggtacagtctctctacatgacacccgaattccgcaatgcaatgtacgaatgggag
tacgtccaattgccggcacacatcaaggaacagaggaagaaagctgagcagagcattcct
tgccaacttcaaaagctcttcctcctacttcaaaccacggaaaacgactcgttggagaca
aaggatttgacacagagcttcggatggacatcaaatgaagcgtacgatcagcatgacgtt
caagaactgtgccgtctgatgtttgatgcgttggagcacaagtggaaaggaacgaagcat
gagaagctgattcaggacttgtacagaggtaccttggaagattttgtggcttgcttgaat
tgcggccgagaaagtgtcaagacggactactttctggatttgtcgcttgccgtgaagcca
tttggagccattcacgcctacaaaagcatcgaggaagcgctcaatgcgtttgtccaacca
gaacttctcaacggctccaatcagtacatgtgcgagaactgcaaaagcaatcaagacgct
cataaaggactccgcatcacacaattcccatatctcttgacaatccagctgaaacgcttc
gatttcgattacaacacaatgcatcgtatcaagctgaacgataagatgacgttcccagat
gtgctggatttgaatgaatatgtgagtaaggagaagcgtccggcgcctacaccttcagca
accaccaccaccacaacgtcaccaccgaaatcagcatggaaaacgattccagcgaaagac
gaggatgacgatatggagctgggatcaccgaatgcgaagagaagcacgccaggaaatcaa
tctccgaaccggtacagctctcgaggcgatgagaatgtgatcgttggccagccaatcgat
catgaatccgtggagagcattatgaagaccaatggtgaagacgtctacgagctattctcc
gtgatggtccactctggcaacgctgcaggtggccactacttcgcctacatcaagaacttg
gatcaggatcggtggtacgtgttcaacgacacgcgggtcgacttcgccactcccagcgaa
gtggagaagagttttggaggacaccccagcggatggaatcagtccaatacgaatgcatac
atgctcatgtacagaaagatcgacagaaaacggaatgccagcttcatcctcagcaaccaa
ttgcctcaacacatcaaggattctcgagagaaatggaagaggctggagcaagaggctgag
gaggagcgtcttcgcaagttgagtctgattcaagtctacgtcaatatcaactatccattc
ccgtcgtatgcgcatctcccggaaaagaagcaactcgatttaacgccacagaagtatcaa
atcgccgatgacttctgcgagtacaaaattgaaatatcgagagagcagccgatcaaatcc
gtgttccaatgtgcctttgattttttcaatgagcgtgctcgtgcctacaacttgcctttc
tccagaaacaattctcgtctgatctacgttgaacacggacagctggaaatggattttcgg
tctccaaaagacatggaaaagaaactgaggtcggtgttcagttcgcatcacggtgaacca
atatccatgtacggtgtgcacttcatcctcgatgttcgtattggttcttcattctttaac
atcgacatccagaataggatgactataaaagtacaacgtgtggatatcggaaagaagacg
actgctaatgagctgactatcgtgatatcaggagatgagaaaatgctgaaagtgaagcaa
tggattggtactcagttcagagatgacattcgtgatgtattggaggcaagagtcgtactg
gaagccgcttcatctagatgtgaattcatgctgattgatagtcagcataattctaaggaa
ttccgaagtcttatatcgcagcacatgggacatgcaacacctacactctactacgatggt
ggcatgagcacaatgatcacagaagagtcgaaggaagcaacaattgctgatcggaaactt
ccattcgaaaagtcccagatgtaccagatccttgatagaaaatgcttctcaacatttgtc
aaagttcgcctgccatcacaagatgaagttgagaaggcggcatcaacgaagaacgcgttc
caaggaccaagttgggaagagactttggccatcatgaaagcggaagatcgactgtggaat
gagccacgagcagcagcagtagaagtgatgtctacagtatccagagccgagacaactgat
gcagtgactgaagtagatgatgagcctatcccatccggaagagggtctacagcatcaatg
cgttctgtgagcatggatgacattgaaggagacattggtatatccggaagtctgtgcaac
aacacaccgcagatgtccccatgtgtatctgagggagacgacattgatgagaaggcattg
gacggtaaatcccagcttatggctgattacatgcagaagacaagtcccgaattctactac
aatcgagatccacagagccctgtgaacaaaaacttgaagattgctctccacgaggagacc
ccatcggaagcattgtcggctgtcagcagtggacaatcaacactcgttccttccacttcg
aatcaagctctctccagtatggctcgtagtgcgatagatgaagcttttgatgccaagata
acaacagtgttctctcatgagaactaccacaaactcgacgtggatagtagaatgagagta
gtcgagttcaagaaatgggtcgccgagcagttgaacatggacaaagatcagttcgtgatt
gtgaagcacgcgtcggatgatggatcggatactggatatgagaccaacttcatggatgat
gaaactgtttctggtgcgttccaatcatgcttcatatctatcaaactgcgagcaccattg
aagcaggatgagaagatgattcaagtcattctgtttgatatgcttgagaatcagagagac
aattggaagccactcttcgaactccctgtatcccagagcacggttattggtgacatcctt
ttgcaatgcattcgaatgtacaatgaggtgtatggagaggagctcacaccgaaagcagtc
cggctacgtgacgtctccactacagggcactacaatgcgaaggcgattctcaacccaaat
gacactttggagaaacgaggatacaactggtgctcgcacatctacatgcagatcgtcacc
gatgaagcagtgcttggtaagcctggagatccaattttggtgaggaggttccgcccgtcg
accgtagaagtcagtccgacgcacgaggtgcttgtcgattcgaatgccgagaatcctgtt
ttgtcgtttatggaagcgctgactaaagtgtctggaattccactggatcggctagcaatc
acagagccgaaagagttcaattggcagaaatggccatttgtaaagagccgtttggatatg
ttggagaacaaagtggcattcgccaaggatctccatctcaactaccccagcccgaaggat
tttgtcgagaagactgggagtcgagttctctactacaaggattcagaagaggagccgaga
attctgacggaggacgagcgcaagcagatcaagattaaagagaacgggcagtcggcgaat
gcgaatcgtcgaaaggagaggccacttcgaattcagatgagcagtgtgtgtgaaggctaa

DBGET integrated database retrieval system