KEGG   Caenorhabditis briggsae: CBG13569Help
Entry
CBG13569          CDS       T01054                                 

Gene name
Cbr-set-23
Definition
C. briggsae CBR-SET-23 protein
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
cbr  Caenorhabditis briggsae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CBG13569 (Cbr-set-23)
Enzymes [BR:cbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CBG13569 (Cbr-set-23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 241 aa AA seqDB search
MNYEEITTTIPGPGVSQDDWNDEFQGCDCETQCSIENQCSCMTGATDNYSEDGRIVATSL
LIECSTNCACCLLPYSCRNKVVQNGIKKKLKIFSTSEKGDGVLAEEPIQNREFVCEYAGE
CIGDQEVKRRCEVFKEEDNYTLTLKEHFGEKEVKTFIDPRLRGNIGRFLNHSCDPNCEIF
VVRLGRMIPIAAIFAKREISVGEELSYDYGVSGIDGDNRKLCLCRSENCRKYLPMSVSPI
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaactatgaggaaattacaacaacgattcctggacccggagtttcccaagacgattgg
aacgacgaattccaaggatgcgattgcgaaacccagtgttctatagagaaccagtgctcc
tgtatgactggcgccactgataattattcagaagacggtagaattgttgccacgtcattg
ctcatagaatgttctacaaattgtgcctgttgtctgcttccctactcgtgtaggaataaa
gttgtgcagaatggaattaaaaagaagttgaagattttcagtacatccgaaaaaggagac
ggtgtccttgccgaagaaccgattcaaaatagagaattcgtttgtgagtacgcaggagaa
tgtattggagatcaagaagtaaagagacgatgcgaagtgttcaaagaagaggacaactac
acattgactctaaaagagcactttggcgaaaaagaagtcaaaactttcatcgatcctaga
ctacgaggaaatatcggacgatttttgaatcatagttgcgatccaaactgtgaaatcttc
gttgtgaggcttggaagaatgattccgattgctgcgatatttgcaaaaagggagatttca
gttggagaagagctgagttacgattacggcgtttcgggaatagatggagataataggaag
ctgtgtctttgtcgatccgagaactgtagaaagtatctaccaatgtctgtttctccaatc
gaataa

DBGET integrated database retrieval system