KEGG   Caenorhabditis briggsae: CBG13606Help
Entry
CBG13606          CDS       T01054                                 

Definition
Hypothetical protein CBG13606
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CBG13606
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG13606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 538 aa AA seqDB search
MLCNHIKVEQCVERVPKTMFRKKQDMEDNNLFLEGNSNRGKPSKGQERFKTFCDECDNCN
KSLMCLTCGRILCGRDDSGHAIEHFEESRHPVVMDCITFELYCYTCDDEVSLDFEPSLYG
VLKSLKLLFDREDIMEGGEGPTINANTSPGLTNVSTNFATKLHVVGEKKGSKKKRGKKGK
VSPMFDTPFQGAVVIDCTNPPASNGGVASSSSSTEIPYRPRGLRNLGNTCFMNAVLQALA
CIKDFREYILNLPSLEDYVEDEKIAQNGNCFLTDEYQKLLASMSARNFRDPTSPNEFREA
FVSACPRFRGFRQHDSHEFLRYLLDQMHTEMRKCRNLPEMPDDKTTPISKSFEGTLQSSV
ICQTCRNVSNKMDDFMDLSLDVPRVSKARYRLSDCLDLFFQRELLEKGEKPECSKCKSKQ
TCSKQMFIKKLPEVLCLHIKRFRDNGGKIDTLIEFPLTGLSVDDFLTEDSDEPPCVYELH
SIIVHIGYGCSSGHYIAFGRRGAKWYQFDDTVVKAMETSNITKQRAYVLMYTKSTRKP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcaatcacattaaagttgaacaatgcgtcgaacgggttcccaaaacgatgttc
cgcaaaaagcaagacatggaggacaataatttattcctggaaggaaactctaaccgaggg
aagccttctaaaggacaagaaagattcaaaaccttctgtgacgagtgcgataattgcaac
aaatcgttgatgtgtctcacttgtggtcgaattttatgcgggagagatgattcagggcat
gctattgagcatttcgaagaatcaagacatccagttgtcatggattgtataactttcgaa
ctctattgctatacatgtgatgatgaggtgtctctggattttgaaccttcgctctatgga
gttctaaaatcgctgaagcttctgttcgacagagaagatataatggaaggaggagaagga
ccaaccataaatgcgaatacctctccaggtctcaccaacgtctccactaatttcgccaca
aaattacacgttgtcggtgagaagaaaggatcgaagaagaaaagaggaaagaaagggaaa
gtgagtccaatgttcgatacaccattccaaggagctgtcgtcatcgattgcacgaatcca
cctgcatcaaatggaggtgtcgcttcttcatcatcgtcaactgagattccgtatcggcca
cgtggattgaggaatctgggaaacacatgcttcatgaatgcagttctgcaggcattagct
tgcataaaagacttccgggagtatattctgaatctgccatcactggaagactatgtagaa
gacgagaagattgcacagaatgggaattgtttcttgacagatgaatatcaaaaactgctg
gcatcaatgtcagcgcgaaatttccgagatccaacttctccgaacgaatttcgcgaagcc
ttcgtctccgcctgtccccggtttcgtggatttcgacaacacgattcgcacgaattcctt
cgatatcttctagatcaaatgcacacggaaatgaggaaatgcaggaatcttccagagatg
cctgatgacaaaactacaccgatttccaagagtttcgagggaacacttcaaagtagtgtc
atttgtcaaacttgtcggaatgttagcaataaaatggacgattttatggatctctcgctg
gacgtaccacgagtctcaaaagcgcggtatcgtttatcggactgcctcgacctatttttc
caacgagaacttttggagaagggagagaaaccggaatgctcaaagtgcaaatcaaagcag
acgtgttcgaagcaaatgttcattaagaagttgccagaagtcctctgcctccatataaag
cgattccgtgataatggtggcaaaattgacactcttatcgaattcccgctaaccggatta
tcagttgatgactttttaacagaagacagtgacgagccaccgtgtgtctacgagcttcat
tcgatcattgttcatattggatatggttgctcatccggtcactatattgcattcggccgc
cgtggcgccaaatggtatcaattcgatgatacagtagtcaaggcaatggaaacgagtaac
atcacaaaacaacgggcatacgtactgatgtacacgaaatccactagaaaaccataa

DBGET integrated database retrieval system