KEGG   Caenorhabditis briggsae: CBG13639Help
Entry
CBG13639          CDS       T01054                                 

Definition
Hypothetical protein CBG13639
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBG13639
  Energy metabolism
   00920 Sulfur metabolism
    CBG13639
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CBG13639
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CBG13639
    3.1.3.25  inositol-phosphate phosphatase
     CBG13639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 298 aa AA seqDB search
MPEIDVDLKDVISYAVLAIEMGGHAVMKVHEEKSLNAAAKGLTDEGKEELLTRADLISNH
LILDILQRFPQLKIVSEEKASEFSDREVEPYRSDNYAVWQSVKEILNQIPSRRLQLSDVR
VFVDPLDATQEFTEGLTEYVTVMACIVVDAEPIFGAIYRPFFNETIFGLQGFGVVTSDGK
KISPVDEGKTDKKVVVSRSHAGKVKEIVEKVYGDKMTIEAAGGSGYKTLRLDVQPTAAQA
ADCAIYTRATRAMSSEEVLEDVENVEDVEDVENVEDVEDVENVEDVENVEDVEDVEKL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatcgatgtagatttgaaagatgtgattagctacgcggttctagccatagaa
atgggtgggcatgcagttatgaaggttcatgaggagaaatctctaaacgccgctgcaaaa
gggctgactgacgagggaaaagaggaattgttaaccagagcagatttgatatcaaaccac
ttgattttggatattttgcaaaggtttccacagctaaaaatagtttccgaggaaaaagcg
tcagagttctcggatcgtgaagtggagccatatcgatcggataactatgcggtttggcag
agtgtgaaggagattctgaaccaaattccatcccgaagacttcaattatctgatgttcga
gtttttgtggatccattggatgcgacccaagagtttacagaaggactaactgaatatgtc
accgtgatggcttgcatcgtagtggacgccgagccgattttcggtgcaatctaccgcccg
tttttcaatgaaacaatattcggcctacaaggattcggagtggtgacgtcggatgggaag
aagatttcacctgtggacgagggaaaaactgataagaaagtggttgtatcgagaagtcat
gcgggaaaagtgaaagaaattgttgagaaggtttacggagataaaatgacaattgaagcg
gctggaggcagtggatataagacgttgaggctggatgtccagccaaccgcagcccaggca
gcggattgtgccatttacacccgagcaacacgagcaatgagttctgaagaagtcctcgaa
gacgtggaaaacgtagaagacgtggaagacgtggaaaacgtggaagacgtggaagacgtg
gaaaacgtggaagacgtggaaaacgtggaagacgtggaagacgttgaaaaattg

DBGET integrated database retrieval system