KEGG   Caenorhabditis briggsae: CBG13639Help
Entry
CBG13639          CDS       T01054                                 

Definition
Hypothetical protein CBG13639
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cbr00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cbr00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cbr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 298 aa AA seqDB search
MPEIDVDLKDVISYAVLAIEMGGHAVMKVHEEKSLNAAAKGLTDEGKEELLTRADLISNH
LILDILQRFPQLKIVSEEKASEFSDREVEPYRSDNYAVWQSVKEILNQIPSRRLQLSDVR
VFVDPLDATQEFTEGLTEYVTVMACIVVDAEPIFGAIYRPFFNETIFGLQGFGVVTSDGK
KISPVDEGKTDKKVVVSRSHAGKVKEIVEKVYGDKMTIEAAGGSGYKTLRLDVQPTAAQA
ADCAIYTRATRAMSSEEVLEDVENVEDVEDVENVEDVEDVENVEDVENVEDVEDVEKL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatcgatgtagatttgaaagatgtgattagctacgcggttctagccatagaa
atgggtgggcatgcagttatgaaggttcatgaggagaaatctctaaacgccgctgcaaaa
gggctgactgacgagggaaaagaggaattgttaaccagagcagatttgatatcaaaccac
ttgattttggatattttgcaaaggtttccacagctaaaaatagtttccgaggaaaaagcg
tcagagttctcggatcgtgaagtggagccatatcgatcggataactatgcggtttggcag
agtgtgaaggagattctgaaccaaattccatcccgaagacttcaattatctgatgttcga
gtttttgtggatccattggatgcgacccaagagtttacagaaggactaactgaatatgtc
accgtgatggcttgcatcgtagtggacgccgagccgattttcggtgcaatctaccgcccg
tttttcaatgaaacaatattcggcctacaaggattcggagtggtgacgtcggatgggaag
aagatttcacctgtggacgagggaaaaactgataagaaagtggttgtatcgagaagtcat
gcgggaaaagtgaaagaaattgttgagaaggtttacggagataaaatgacaattgaagcg
gctggaggcagtggatataagacgttgaggctggatgtccagccaaccgcagcccaggca
gcggattgtgccatttacacccgagcaacacgagcaatgagttctgaagaagtcctcgaa
gacgtggaaaacgtagaagacgtggaagacgtggaaaacgtggaagacgtggaagacgtg
gaaaacgtggaagacgtggaaaacgtggaagacgtggaagacgttgaaaaattg

DBGET integrated database retrieval system