KEGG   Caenorhabditis briggsae: CBG13719Help
Entry
CBG13719          CDS       T01054                                 

Definition
Hypothetical protein CBG13719
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cbr  Caenorhabditis briggsae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CBG13719
  Replication and repair
   03420 Nucleotide excision repair
    CBG13719
Transcription machinery [BR:cbr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CBG13719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 482 aa AA seqDB search
MSASSSSAPSEAPANTTGVSSSRHSCLFLDFLMSIKPKDRQRMLQKPSCSFFIYRMLPAI
AQQVTIQLIWKGSFPKADDVELTKSIEEQVELLLKLGIAHKATDGKLTIDNDYKRSYMYA
AMLGAASISSLVLETNDEKRRGKDVEKKAVERWDCILRYLALPSEENTEAVSDTTKDLFR
KANFTSGESRIEITTFGFQFLLLSPVKQMWTYVIEYLKLEISKGNDIVEVIEPLIQIVLL
ANRGFKAEKECYQIDEQWTQPQHDLLNHLRELGVIFIRKRKDGVFFLTHLLTHLATNETI
DDTSSEKASNGKVIVETNFRVYAYTSSLLQLAIIALFTEMTYRFTDMSVGMITRESVRGA
LQHGITAAQIISFLRANAHPQCVATSGPVNCLPITVADQIRLWEDERRRMDLKDAYIYSH
FESDDEYHGVVRYAQERGILLWANPQQKLVIVNEEGHEAVRQWYKRSKGASGDSGGPSTS
SA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatcgtcaagctccgccccttcggaggcgccagccaacacgactggcgtgagc
tcatccagacattcgtgtctttttttggactttttgatgtcaattaagccgaaagatcga
caacggatgctccagaaaccgtcttgctcattcttcatctaccgtatgcttccggcgatt
gctcagcaagtcacgattcagctcatttggaaaggcagttttccaaaagccgacgatgtg
gaattgacaaaatcgattgaggaacaagtcgagctgctcctgaaactgggaattgctcat
aaggcaacagatggaaaattgacaattgataacgactacaaacgatcgtatatgtacgcg
gcgatgctcggcgcggcgagcatttcgagcctcgttttggagacgaacgacgagaaacga
cgtggaaaagatgtcgaaaaaaaggcggtcgagagatgggactgcattttgagatatctc
gctctcccgtccgaagagaacaccgaagccgtctcagacaccaccaaggacctattccga
aaagccaacttcaccagcggcgagtctcgaatcgaaatcaccacatttggtttccaattt
ctattgctcagcccagtgaaacaaatgtggacgtacgtcatagaatacctgaaattggag
atctccaaaggaaacgacatcgttgaagtcatcgaaccactcattcaaattgtgctccta
gccaatagaggattcaaagcggaaaaagagtgttatcagattgatgagcaatggacacaa
ccgcaacacgaccttctgaatcatctaagagaattgggggtcattttcattcggaaacga
aaagacggtgtctttttcttgacacaccttctaacccatttggcaaccaacgagactatt
gacgacacgtcatctgagaaggcgtcgaatggaaaagtgattgtggagacgaatttcagg
gtttacgcgtatacgtcgtcgcttttgcagctggcgattatcgcgcttttcacggaaatg
acgtatagattcacggacatgtccgtcggcatgatcacccgcgaatcggtccgtggagcc
cttcaacacggcatcaccgccgcccaaatcatctcattcctccgtgccaacgcccatcca
cagtgtgtcgccacatcggggcccgtcaattgtttgccgattacggtcgccgatcaaatc
cgcttgtgggaagacgaacgtcgtcgtatggacctgaaggacgcctacatctattcgcac
tttgaatccgacgacgagtatcacggcgtcgtcagatacgctcaagagcgtggaattctg
ctctgggcgaatccccaacagaagttggtcattgtgaatgaggagggacatgaagccgtt
cgacagtggtacaagagaagcaaaggagccagtggagattctggaggaccatcaacgtct
tctgcataa

DBGET integrated database retrieval system