KEGG   Caenorhabditis briggsae: CBG13882Help
Entry
CBG13882          CDS       T01054                                 

Definition
Hypothetical protein CBG13882
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cbr00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cbr00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:cbr00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:cbr04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 329 aa AA seqDB search
MPRICVLGAGIMGVSTALAIQERIPDSVVTIIAEKFSPNTTSDVAAGLIEPYLCDDDVDR
VISWTKSTIQRIQEYMNEGNPGAESQEQSGYWLQSVKSVPKWLEVMKNVKILTGNELKMV
AKRPEHKFGIFYTTWYLEPTPYIKWESDKFLKNGGKIKNSKIQKIEDVEKEFGLFDVILN
CTGIGARHLIGDNEVFPTRGQILKVKCPSVKHFFIDDQFYALLNDTTITLGGTADRHQWD
RTINPKISEKIFQENCKNIPSLRSAQVISSHVDLRPSRVTVRLEAEPDSKVIHNNGHGGS
GITLHWGCALECVELVKKVLAGKPGISKI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaatctgtgtcctgggtgctggaataatgggcgtctccacagcgttggccatt
caggaacgaattccggactctgtggtcaccataatcgccgagaaattctctccaaacacg
acgagtgacgttgccgctggtctcattgaaccctatctttgtgatgatgacgtggaccgt
gttataagttggacaaaatcaactattcagcgtattcaggaatacatgaatgaagggaac
cctggagcagagagtcaggagcaatccggttattggcttcaaagtgtgaaatcggtgccg
aaatggttggaagtcatgaaaaatgtgaaaattttgactggaaatgagctgaaaatggtc
gccaagcgaccagaacacaaattcggcattttctacacaacttggtacctggaaccaaca
ccgtatatcaaatgggaatccgataaatttttgaaaaatggcgggaaaatcaaaaattca
aaaattcaaaagatagaagacgtcgaaaaggaattcgggctcttcgatgtgattctgaac
tgtactggaattggagcaagacatttaattggggataatgaagtctttccgacaagggga
caaattttaaaggtcaaatgcccaagtgttaagcatttcttcattgatgatcagttttat
gcacttttaaacgacaccaccattaccctcggcggaaccgccgatcgtcaccagtgggat
cgaaccataaatcccaaaatttctgaaaaaatattccaagaaaactgcaaaaacattcca
tctcttcgatccgctcaagtcatctcaagccacgtggatttgcgaccatctcgagttaca
gtaagattggaggcggagcctgattcgaaagttattcataacaatggacatggcggatct
ggaatcacccttcattggggttgtgctctcgagtgtgtcgagttggtcaagaaagttttg
gcgggaaaaccaggaatttcgaaaatttga

DBGET integrated database retrieval system