KEGG   Caenorhabditis briggsae: CBG13882Help
Entry
CBG13882          CDS       T01054                                 

Definition
Hypothetical protein CBG13882
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBG13882
   00330 Arginine and proline metabolism
    CBG13882
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CBG13882
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CBG13882
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CBG13882
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     CBG13882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 329 aa AA seqDB search
MPRICVLGAGIMGVSTALAIQERIPDSVVTIIAEKFSPNTTSDVAAGLIEPYLCDDDVDR
VISWTKSTIQRIQEYMNEGNPGAESQEQSGYWLQSVKSVPKWLEVMKNVKILTGNELKMV
AKRPEHKFGIFYTTWYLEPTPYIKWESDKFLKNGGKIKNSKIQKIEDVEKEFGLFDVILN
CTGIGARHLIGDNEVFPTRGQILKVKCPSVKHFFIDDQFYALLNDTTITLGGTADRHQWD
RTINPKISEKIFQENCKNIPSLRSAQVISSHVDLRPSRVTVRLEAEPDSKVIHNNGHGGS
GITLHWGCALECVELVKKVLAGKPGISKI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaatctgtgtcctgggtgctggaataatgggcgtctccacagcgttggccatt
caggaacgaattccggactctgtggtcaccataatcgccgagaaattctctccaaacacg
acgagtgacgttgccgctggtctcattgaaccctatctttgtgatgatgacgtggaccgt
gttataagttggacaaaatcaactattcagcgtattcaggaatacatgaatgaagggaac
cctggagcagagagtcaggagcaatccggttattggcttcaaagtgtgaaatcggtgccg
aaatggttggaagtcatgaaaaatgtgaaaattttgactggaaatgagctgaaaatggtc
gccaagcgaccagaacacaaattcggcattttctacacaacttggtacctggaaccaaca
ccgtatatcaaatgggaatccgataaatttttgaaaaatggcgggaaaatcaaaaattca
aaaattcaaaagatagaagacgtcgaaaaggaattcgggctcttcgatgtgattctgaac
tgtactggaattggagcaagacatttaattggggataatgaagtctttccgacaagggga
caaattttaaaggtcaaatgcccaagtgttaagcatttcttcattgatgatcagttttat
gcacttttaaacgacaccaccattaccctcggcggaaccgccgatcgtcaccagtgggat
cgaaccataaatcccaaaatttctgaaaaaatattccaagaaaactgcaaaaacattcca
tctcttcgatccgctcaagtcatctcaagccacgtggatttgcgaccatctcgagttaca
gtaagattggaggcggagcctgattcgaaagttattcataacaatggacatggcggatct
ggaatcacccttcattggggttgtgctctcgagtgtgtcgagttggtcaagaaagttttg
gcgggaaaaccaggaatttcgaaaatttga

DBGET integrated database retrieval system