KEGG   Caenorhabditis briggsae: CBG14058Help
Entry
CBG14058          CDS       T01054                                 

Gene name
Cbr-hex-1
Definition
C. briggsae CBR-HEX-1 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CBG14058 (Cbr-hex-1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CBG14058 (Cbr-hex-1)
   00603 Glycosphingolipid biosynthesis - globo series
    CBG14058 (Cbr-hex-1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    CBG14058 (Cbr-hex-1)
   00511 Other glycan degradation
    CBG14058 (Cbr-hex-1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CBG14058 (Cbr-hex-1)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CBG14058 (Cbr-hex-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 557 aa AA seqDB search
MGFEVMRLIVLSLLFTSTLAWFYGRDEPDRWSVGGVWPLPQKIIYGSKNRTLTYDKIGID
LGDKKDCDVLLAMADNYMNKWLFPYPVEMKTGGTEDFIITVTVKEECPGGPPVHGASEEY
LLRVSVSEAVINAQTVWGALRAMETLSHLVFYDQKSQEYQIRTAEIFDKPRFPVRGIMID
SSRHFLSLNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSQKFPELHGVGAYSPRHVYSR
EDISEVIAFARLRGIRVIPEFDLPGHTSSWKGRKGFLTECFDEKGEETFLPNLVDPMNDA
NFDFLAEFLEEVTETFPDQFLHLGGDEVSDYIVECWVRNKKIRKFMDEKGFGNNTVLLEN
YFFEKLFSIVEKLKLKRKPIFWQEVFDNNIPDPNSIIHIWKGNTHEEIYEQVKNITSKNF
PVIVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTSFNGTDTQKNLVLGGIAAIWG
ELVDNTNIEARLWPRASAAAERLWSPAEKTQKAENAWPRMHELRCRLVSRGYRIQPNNNP
DYCPFEFDEPPATKSEL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgaggtaatgcgacttatagttctatctttgttatttacctccacacttgcg
tggttctatggccgagacgagccggatcgttggagtgtcggaggggtatggcctctccca
cagaaaattatctacggctccaagaaccgtacgcttacttatgataaaatcggaatcgat
cttggagacaagaaggattgcgatgttctcctggcaatggcggacaattatatgaacaaa
tggttgtttccatacccagttgagatgaaaaccggtggaactgaagatttcattatcaca
gtcacagtgaaagaagagtgcccaggaggaccaccagttcacggagctagtgaggagtat
ctgttgcgtgtcagtgtctcggaggcagtcattaacgcacaaaccgtatggggagcactt
cgcgcaatggaaacattgagtcatctggttttttatgatcagaagtctcaagagtatcaa
atccgcacagctgaaatctttgacaaacctcgtttcccggttcgtggaattatgatcgac
tccagccgtcatttcttatctctaaacgttatcaaacgccaattagagatcatgtcaatg
aacaaactcaatgttctccattggcatcttgtggacagtgagtccttcccgtacacctct
cagaagtttccagagcttcatggagtgggtgcctattctcctcgtcacgtctactctcga
gaggatatttctgaagttattgcatttgccagacttcgtggtattcgtgtcatccctgaa
ttcgatttaccgggacacacttcatcctggaagggtcgcaaaggttttctaaccgaatgt
tttgatgagaagggagaagaaacattcttgccaaatttggtggatccaatgaatgatgcc
aattttgactttcttgctgagttcctggaagaggtcactgaaacattccctgatcagttt
ttgcatctcggtggtgatgaggtctcagattacattgtggagtgttgggtccggaataaa
aaaattcggaagttcatggatgagaagggatttggaaataatactgtgctccttgaaaat
tatttcttcgaaaaactattttctattgtggaaaaactcaaattgaaacgcaaaccaatc
ttctggcaagaagtgttcgacaacaacattcccgatccaaactcgattatccatatttgg
aagggaaatacacacgaggagatttatgagcaggtgaagaatatcacatcgaaaaacttt
ccggtgattgtgtccgcatgctggtacttgaactatatcaagtacggcgccgattggaga
gacgagattcgtggaactgctccgtccaactcaagatactactactgtgacccaaccagt
ttcaatggaactgatactcagaaaaatctagtgcttggaggaatagctgcgatctgggga
gagttggtggataacactaatattgaagctagattatggccaagagcgtcagcagcggcc
gaaagactttggtcaccagccgaaaagacacaaaaagccgaaaacgcgtggccccgaatg
cacgaactgcgttgtagattggtctccagaggataccgtattcagccgaacaacaatccc
gactattgtccattcgagtttgatgagcctccagcgaccaagtcggagctttaa

DBGET integrated database retrieval system