KEGG   Caenorhabditis briggsae: CBG14305Help
Entry
CBG14305          CDS       T01054                                 

Definition
Hypothetical protein CBG14305
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG14305
   04310 Wnt signaling pathway
    CBG14305
   04340 Hedgehog signaling pathway
    CBG14305
   04020 Calcium signaling pathway
    CBG14305
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CBG14305
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CBG14305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 371 aa AA seqDB search
MSSSTSSVESVEDESCSNECSASFTFDTNNNSRGDQQVDELAEETHMKLSITPTRESFSL
SQLERIVTIGKGTFGRVELARDKISGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKH
PFIVKMYASEKDSNNLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSL
GIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVD
WWALGILIYEMMVGKPPFRGKTTAEIYDSIIEHKLKFPRSFNLAAKDLVKKLLEVDRTQR
IGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDYEEDTTGGPLC
SQRERDLFAEW
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttcgacatcatcagtggaatcagtcgaagatgagagttgctccaacgagtgc
tcagcctcgttcacatttgacaccaacaacaacagtcgtggcgaccaacaagtggatgag
cttgccgaggaaactcacatgaagttgagcatcacgccaacgcgtgaatccttctcattg
agccagttggaacgtattgtaacaattggaaaagggactttcggacgtgtcgaattggct
cgggacaagattagtggagcacattatgcgctgaaagtgctcaatattcgtcgtgtcgtt
gacatgcgtcaaactcaacacgttcataacgagaagcgtgttcttcttcagttgaagcat
ccgttcattgtaaaaatgtacgcttcagaaaaggacagcaacaacttgtacatgattatg
gagttcgttccaggaggtgaaatgttttcgtacctcagagcatcgagatccttctccaac
tcaatggcccgcttctacgcttcagagatcgtgtgtgctttggagtacattcactccctc
ggaattgtctaccgagacttaaaaccagaaaacttgatgctcagcaaagaaggccacatc
aaaatggctgatttcggatttgcgaaagaactccgcgacagaacctacacaatctgtgga
actccggactaccttgcaccagagtctctggccagaactggtcacaacaagggtgtcgac
tggtgggcgttgggaattctgatctatgagatgatggttggaaagccaccattccgtgga
aagaccaccgccgaaatctacgattcgattatcgagcataaactcaaatttccaagaagc
ttcaatcttgccgcaaaagatctcgtcaaaaaactgctggaggttgatagaacccagcgc
atcgggtgcatgaagaatggcacacaagatgtcaaggaccataaatggttcgagaaggtc
aattgggatgatacccttcatctgagagttgagccaccaatcgttccaacattgtatcat
ccaggagatacgggaaacttcgatgactacgaagaagacacaaccggtggaccattgtgt
agtcaacgtgaacgcgatctttttgccgagtggtaa

DBGET integrated database retrieval system