KEGG   Caenorhabditis briggsae: CBG14305Help
Entry
CBG14305          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG14305
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CBG14305
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   CBG14305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 371 aa AA seqDB search
MSSSTSSVESVEDESCSNECSASFTFDTNNNSRGDQQVDELAEETHMKLSITPTRESFSL
SQLERIVTIGKGTFGRVELARDKISGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKH
PFIVKMYASEKDSNNLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSL
GIVYRDLKPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVD
WWALGILIYEMMVGKPPFRGKTTAEIYDSIIEHKLKFPRSFNLAAKDLVKKLLEVDRTQR
IGCMKNGTQDVKDHKWFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDYEEDTTGGPLC
SQRERDLFAEW
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttcgacatcatcagtggaatcagtcgaagatgagagttgctccaacgagtgc
tcagcctcgttcacatttgacaccaacaacaacagtcgtggcgaccaacaagtggatgag
cttgccgaggaaactcacatgaagttgagcatcacgccaacgcgtgaatccttctcattg
agccagttggaacgtattgtaacaattggaaaagggactttcggacgtgtcgaattggct
cgggacaagattagtggagcacattatgcgctgaaagtgctcaatattcgtcgtgtcgtt
gacatgcgtcaaactcaacacgttcataacgagaagcgtgttcttcttcagttgaagcat
ccgttcattgtaaaaatgtacgcttcagaaaaggacagcaacaacttgtacatgattatg
gagttcgttccaggaggtgaaatgttttcgtacctcagagcatcgagatccttctccaac
tcaatggcccgcttctacgcttcagagatcgtgtgtgctttggagtacattcactccctc
ggaattgtctaccgagacttaaaaccagaaaacttgatgctcagcaaagaaggccacatc
aaaatggctgatttcggatttgcgaaagaactccgcgacagaacctacacaatctgtgga
actccggactaccttgcaccagagtctctggccagaactggtcacaacaagggtgtcgac
tggtgggcgttgggaattctgatctatgagatgatggttggaaagccaccattccgtgga
aagaccaccgccgaaatctacgattcgattatcgagcataaactcaaatttccaagaagc
ttcaatcttgccgcaaaagatctcgtcaaaaaactgctggaggttgatagaacccagcgc
atcgggtgcatgaagaatggcacacaagatgtcaaggaccataaatggttcgagaaggtc
aattgggatgatacccttcatctgagagttgagccaccaatcgttccaacattgtatcat
ccaggagatacgggaaacttcgatgactacgaagaagacacaaccggtggaccattgtgt
agtcaacgtgaacgcgatctttttgccgagtggtaa

DBGET integrated database retrieval system