KEGG   Caenorhabditis briggsae: CBG14388Help
Entry
CBG14388          CDS       T01054                                 

Gene name
Cbr-cka-2
Definition
C. briggsae CBR-CKA-2 protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBG14388 (Cbr-cka-2)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CBG14388 (Cbr-cka-2)
    2.7.1.82  ethanolamine kinase
     CBG14388 (Cbr-cka-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 429 aa AA seqDB search
MSSRKVSRAHYDEDELQSAANMSLVAEGHFRGMKELLSSMDLDTDANTIPELKERAHMLC
ARFLGGAWKTVPLEHLRISRIKGGMSNMLFLCRLSEVYPPIRNEPNKVLLRVYFNPETES
HLVAESVIFTLLSERHLGPKLYGIFSGGRLEEYIPSRPLSCHEISLSHMSTKIAKRVAKV
HQLEVPIWKEPDYLCEALQRWLKQLTGTVAAEHRFELPEECGVSSVNCMDLARELEFLRA
HISLSKSPVTFCHNDLQEGNILLPKASSGNIRMPSLSDEIQALGNSLSAFNPADPRLVLI
DFEYASYNYRAFDFANHFIEWTIDYDIQEAPFYKIQPENFPEDEQMLEFFVNYLREQGNT
RENELYKKSEELVQETLPFVPVSHFFWGVWGLLQVELSPVGFGFADYGRDRLSQYFKHKQ
LLKNLALHH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccgaaaagtttcccgtgctcactacgacgaggacgaactacaatccgctgca
aacatgagtctcgttgcagaaggacatttcagaggcatgaaggagttactctccagcatg
gaccttgacaccgacgcaaatactatcccggagctcaaagaacgtgctcatatgctctgc
gctcgtttcctgggcggagcatggaaaactgttccattggagcatttgcgtatcagccgt
attaagggtggaatgagcaatatgctcttcttgtgccgattgtcggaggtctatccaccg
attcgcaacgagccgaacaaggtgcttctccgtgtctacttcaacccggagactgaaagc
cacctcgtcgccgagtctgtcattttcacgcttctctccgagcgccacttgggtccaaaa
ctttatggcattttcagtggcggacgtttggaggagtacattccgtctcgtccattgtcg
tgccacgagatctcgctgtctcacatgtcgacgaaaatagcaaagcgtgttgccaaggtt
caccaattggaggttccaatctggaaggagccagactacttgtgcgaggctcttcagaga
tggctcaaacaactcactggaactgtcgctgccgagcatcgcttcgagcttccagaagag
tgcggagtttccagcgtcaattgcatggatctagcgcgcgaactcgagttcttgcgtgct
cacatctcgctcagcaagagtccagtgacattctgtcacaacgacctgcaagaaggtaac
attcttctaccaaaggcgtcttctggaaatatccgtatgccgtcgttgtcggatgagatc
caagcgcttggaaatagcctttcggctttcaacccagccgatcctcgtcttgtgttgatc
gattttgagtacgccagctataactacagagcattcgattttgccaaccatttcattgaa
tggaccatcgactatgatatccaagaggctccattctacaagattcaaccggagaacttc
ccagaggatgaacagatgctcgagttctttgtcaactatcttcgtgagcaagggaacact
cgtgagaacgaactctacaagaaatccgaggagcttgtccaagagacgcttccatttgtt
ccagtctctcattttttctggggcgtctggggattgcttcaagttgaactttctccagtt
ggatttggattcgcggattacggaagagatcgtctctcgcaatatttcaagcacaagcag
cttctcaagaatcttgctcttcaccattga

DBGET integrated database retrieval system